BLASTX nr result
ID: Cocculus22_contig00011548
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus22_contig00011548 (430 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_173491.1| hypothetical protein NitaMp154 [Nicotiana tabac... 48 3e-09 ref|YP_002608396.1| orf86 [Vitis vinifera] gi|209954193|emb|CAQ7... 51 8e-09 >ref|YP_173491.1| hypothetical protein NitaMp154 [Nicotiana tabacum] gi|56806656|dbj|BAD83557.1| hypothetical protein (mitochondrion) [Nicotiana tabacum] Length = 103 Score = 48.1 bits (113), Expect(2) = 3e-09 Identities = 21/41 (51%), Positives = 26/41 (63%) Frame = +2 Query: 53 LQSCSSEAGLRICPPQRPEERWLSCLTRRRRLILGVSTLEK 175 +Q CS EAG+R CPP PEE+WL C R +R V TL + Sbjct: 1 MQRCSFEAGVRNCPPHHPEEQWLCCFARLQRETPKVPTLNR 41 Score = 38.9 bits (89), Expect(2) = 3e-09 Identities = 27/55 (49%), Positives = 30/55 (54%), Gaps = 6/55 (10%) Frame = +3 Query: 165 RSKKQSNICLTQAPGTSGHK---GYELHCPG---KGIERVGSAIALLSFAKSRRE 311 R K+QS ICLT APG H+ L G K IER A+ALL AK RRE Sbjct: 41 RKKEQSTICLTHAPGIPRHRERVRANLLLEGKLAKSIERACYALALLPSAKLRRE 95 >ref|YP_002608396.1| orf86 [Vitis vinifera] gi|209954193|emb|CAQ77655.1| orf86 [Vitis vinifera] gi|239764741|gb|ACS15212.1| ORF86 [Vitis vinifera] Length = 86 Score = 50.8 bits (120), Expect(2) = 8e-09 Identities = 23/41 (56%), Positives = 28/41 (68%) Frame = +2 Query: 53 LQSCSSEAGLRICPPQRPEERWLSCLTRRRRLILGVSTLEK 175 +Q CSSEA +R CPP RPEE+WL C R +R I V TL + Sbjct: 1 MQRCSSEARVRDCPPHRPEEQWLCCFARLQRDIPKVPTLNR 41 Score = 34.7 bits (78), Expect(2) = 8e-09 Identities = 14/22 (63%), Positives = 16/22 (72%) Frame = +3 Query: 165 RSKKQSNICLTQAPGTSGHKGY 230 R K+QS ICLT APG H+GY Sbjct: 41 RKKEQSTICLTHAPGIPRHRGY 62