BLASTX nr result
ID: Cocculus22_contig00011418
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus22_contig00011418 (399 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADU56182.1| 12-oxophytodienoate reductase [Jatropha curcas] 58 1e-06 ref|XP_002524496.1| 12-oxophytodienoate reductase opr, putative ... 58 2e-06 ref|XP_002516287.1| 12-oxophytodienoate reductase opr, putative ... 57 2e-06 ref|XP_004973624.1| PREDICTED: 12-oxophytodienoate reductase 7-l... 56 6e-06 ref|NP_001105833.1| 12-oxo-phytodienoic acid reductase8 [Zea may... 56 6e-06 gb|ACL53987.1| unknown [Zea mays] gi|413921960|gb|AFW61892.1| hy... 56 6e-06 gb|ACG34147.1| 12-oxophytodienoate reductase 3 [Zea mays] 56 6e-06 ref|XP_007204383.1| hypothetical protein PRUPE_ppa006756mg [Prun... 55 8e-06 >gb|ADU56182.1| 12-oxophytodienoate reductase [Jatropha curcas] Length = 190 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/39 (69%), Positives = 32/39 (82%) Frame = +2 Query: 2 PLNRYVRATFYTPDPVAGFTDYPFLSQVQHKKQEPISRL 118 PLN+YVR TFYT DPV G+TDYPFLS+V + QEP+S L Sbjct: 153 PLNKYVRKTFYTQDPVVGYTDYPFLSEV-NGNQEPLSPL 190 >ref|XP_002524496.1| 12-oxophytodienoate reductase opr, putative [Ricinus communis] gi|223536284|gb|EEF37936.1| 12-oxophytodienoate reductase opr, putative [Ricinus communis] Length = 396 Score = 57.8 bits (138), Expect = 2e-06 Identities = 25/37 (67%), Positives = 29/37 (78%) Frame = +2 Query: 2 PLNRYVRATFYTPDPVAGFTDYPFLSQVQHKKQEPIS 112 PLN+Y R TFYT DPV G+TDYPFLSQ+ K+EP S Sbjct: 358 PLNKYDRETFYTSDPVIGYTDYPFLSQLTDGKEEPFS 394 >ref|XP_002516287.1| 12-oxophytodienoate reductase opr, putative [Ricinus communis] gi|223544773|gb|EEF46289.1| 12-oxophytodienoate reductase opr, putative [Ricinus communis] Length = 391 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/39 (64%), Positives = 33/39 (84%) Frame = +2 Query: 2 PLNRYVRATFYTPDPVAGFTDYPFLSQVQHKKQEPISRL 118 PLN+Y+R TFYTPDPV G+TDYPFLS+ ++ Q+ +SRL Sbjct: 354 PLNKYIRKTFYTPDPVVGYTDYPFLSK-ENGSQQLLSRL 391 >ref|XP_004973624.1| PREDICTED: 12-oxophytodienoate reductase 7-like [Setaria italica] Length = 397 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = +2 Query: 2 PLNRYVRATFYTPDPVAGFTDYPFLSQ 82 PLNRYVR TFYTPDPV G+TDYPFL Q Sbjct: 366 PLNRYVRKTFYTPDPVVGYTDYPFLGQ 392 >ref|NP_001105833.1| 12-oxo-phytodienoic acid reductase8 [Zea mays] gi|63021733|gb|AAY26528.1| 12-oxo-phytodienoic acid reductase [Zea mays] gi|194691498|gb|ACF79833.1| unknown [Zea mays] gi|219887301|gb|ACL54025.1| unknown [Zea mays] gi|413921961|gb|AFW61893.1| 12-oxo-phytodienoic acid reductase [Zea mays] Length = 399 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = +2 Query: 2 PLNRYVRATFYTPDPVAGFTDYPFLSQ 82 PLNRYVR TFYTPDPV G+TDYPFL Q Sbjct: 368 PLNRYVRKTFYTPDPVVGYTDYPFLGQ 394 >gb|ACL53987.1| unknown [Zea mays] gi|413921960|gb|AFW61892.1| hypothetical protein ZEAMMB73_640948 [Zea mays] Length = 250 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = +2 Query: 2 PLNRYVRATFYTPDPVAGFTDYPFLSQ 82 PLNRYVR TFYTPDPV G+TDYPFL Q Sbjct: 219 PLNRYVRKTFYTPDPVVGYTDYPFLGQ 245 >gb|ACG34147.1| 12-oxophytodienoate reductase 3 [Zea mays] Length = 399 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = +2 Query: 2 PLNRYVRATFYTPDPVAGFTDYPFLSQ 82 PLNRYVR TFYTPDPV G+TDYPFL Q Sbjct: 368 PLNRYVRKTFYTPDPVVGYTDYPFLGQ 394 >ref|XP_007204383.1| hypothetical protein PRUPE_ppa006756mg [Prunus persica] gi|462399914|gb|EMJ05582.1| hypothetical protein PRUPE_ppa006756mg [Prunus persica] Length = 396 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/39 (66%), Positives = 30/39 (76%) Frame = +2 Query: 2 PLNRYVRATFYTPDPVAGFTDYPFLSQVQHKKQEPISRL 118 PL RY R TFYT DPV G+TDYPFLS + K+EP+SRL Sbjct: 359 PLTRYNRKTFYTQDPVVGYTDYPFLSNA-NGKEEPLSRL 396