BLASTX nr result
ID: Cocculus22_contig00011112
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus22_contig00011112 (793 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABD96942.1| hypothetical protein [Cleome spinosa] 55 2e-07 dbj|BAB09379.1| non-LTR retroelement reverse transcriptase-like ... 55 6e-07 gb|AAD24652.1| putative non-LTR retroelement reverse transcripta... 50 2e-06 emb|CAB45965.1| putative reverse transcriptase [Arabidopsis thal... 52 3e-06 gb|AAG51098.1|AC025295_6 hypothetical protein [Arabidopsis thali... 53 5e-06 emb|CAB39942.1| putative protein [Arabidopsis thaliana] gi|72678... 53 8e-06 >gb|ABD96942.1| hypothetical protein [Cleome spinosa] Length = 402 Score = 55.5 bits (132), Expect(2) = 2e-07 Identities = 30/77 (38%), Positives = 39/77 (50%) Frame = -2 Query: 657 LRCKPMEEGGRGLGRIKDVSRAATLKLIWWLATEKVNLWVNWIHEHY*KSYCFWDCLP*E 478 L C+P EEGG G+ R++D S LK IW + E +LWV W+ E+ K FW L + Sbjct: 206 LVCQPKEEGGLGIRRLEDFSSIFRLKSIWMIFKESGSLWVAWLKENVFKKRGFWGALRSQ 265 Query: 477 FFLLDLEKNPQLKSHCR 427 L K K H R Sbjct: 266 RQSCHLRKLLGYKDHAR 282 Score = 26.9 bits (58), Expect(2) = 2e-07 Identities = 11/29 (37%), Positives = 15/29 (51%) Frame = -1 Query: 409 LIGKGDTVKFWLDPWSPMWYW*ESLGKTG 323 ++G G T FW D W+ M E +G G Sbjct: 288 VLGNGKTTTFWHDDWTGMGPLIERIGAAG 316 >dbj|BAB09379.1| non-LTR retroelement reverse transcriptase-like protein [Arabidopsis thaliana] Length = 1223 Score = 55.5 bits (132), Expect(2) = 6e-07 Identities = 20/53 (37%), Positives = 33/53 (62%) Frame = -2 Query: 651 CKPMEEGGRGLGRIKDVSRAATLKLIWWLATEKVNLWVNWIHEHY*KSYCFWD 493 CKP +EGG GL +K+ + LKL+W + + +LWV W+ +H ++ FW+ Sbjct: 866 CKPKDEGGLGLRSLKEANDVCCLKLVWKIVSHSNSLWVKWVDQHLLRNASFWE 918 Score = 25.0 bits (53), Expect(2) = 6e-07 Identities = 10/28 (35%), Positives = 12/28 (42%) Frame = -1 Query: 406 IGKGDTVKFWLDPWSPMWYW*ESLGKTG 323 +G G FW D WS + E G G Sbjct: 948 VGNGKQTSFWYDNWSDLGQLLERTGDRG 975 >gb|AAD24652.1| putative non-LTR retroelement reverse transcriptase [Arabidopsis thaliana] Length = 977 Score = 50.4 bits (119), Expect(2) = 2e-06 Identities = 20/52 (38%), Positives = 31/52 (59%) Frame = -2 Query: 651 CKPMEEGGRGLGRIKDVSRAATLKLIWWLATEKVNLWVNWIHEHY*KSYCFW 496 CKP +EGG GL +K+ + LK++W + + +LWV WI + K+ FW Sbjct: 823 CKPKKEGGLGLRSLKEANDVCCLKVVWKIVSHGNSLWVKWIEKFLLKNETFW 874 Score = 28.1 bits (61), Expect(2) = 2e-06 Identities = 11/28 (39%), Positives = 14/28 (50%) Frame = -1 Query: 406 IGKGDTVKFWLDPWSPMWYW*ESLGKTG 323 + KG+ FW D WS M E +G G Sbjct: 905 VNKGNCTSFWYDDWSNMGQMVEKVGDRG 932 >emb|CAB45965.1| putative reverse transcriptase [Arabidopsis thaliana] gi|7267919|emb|CAB78261.1| putative reverse transcriptase [Arabidopsis thaliana] Length = 662 Score = 51.6 bits (122), Expect(2) = 3e-06 Identities = 22/52 (42%), Positives = 30/52 (57%) Frame = -2 Query: 651 CKPMEEGGRGLGRIKDVSRAATLKLIWWLATEKVNLWVNWIHEHY*KSYCFW 496 C+P EGG GL IK+ + LKLIW + ++ +LWV WI + K FW Sbjct: 384 CRPKREGGLGLQSIKEANDVCCLKLIWRIVSQGDSLWVQWIRTYLLKRNTFW 435 Score = 26.6 bits (57), Expect(2) = 3e-06 Identities = 11/29 (37%), Positives = 15/29 (51%) Frame = -1 Query: 406 IGKGDTVKFWLDPWSPMWYW*ESLGKTGE 320 I G+T FW D WS + LG+ G+ Sbjct: 465 IRNGETASFWYDDWSSKGRLIDVLGERGQ 493 >gb|AAG51098.1|AC025295_6 hypothetical protein [Arabidopsis thaliana] Length = 504 Score = 52.8 bits (125), Expect(2) = 5e-06 Identities = 23/52 (44%), Positives = 29/52 (55%) Frame = -2 Query: 651 CKPMEEGGRGLGRIKDVSRAATLKLIWWLATEKVNLWVNWIHEHY*KSYCFW 496 CKP EEGG GL +K+ + LKLIW + + +LWV WI K FW Sbjct: 196 CKPKEEGGLGLRSLKEANDVCCLKLIWRIISHADSLWVKWIQSSLLKKVFFW 247 Score = 24.6 bits (52), Expect(2) = 5e-06 Identities = 11/28 (39%), Positives = 12/28 (42%) Frame = -1 Query: 406 IGKGDTVKFWLDPWSPMWYW*ESLGKTG 323 I G FW D WS + ES G G Sbjct: 278 INNGAQTSFWYDDWSDLGRLIESAGDRG 305 >emb|CAB39942.1| putative protein [Arabidopsis thaliana] gi|7267871|emb|CAB78214.1| putative protein [Arabidopsis thaliana] Length = 473 Score = 53.1 bits (126), Expect(2) = 8e-06 Identities = 23/52 (44%), Positives = 29/52 (55%) Frame = -2 Query: 651 CKPMEEGGRGLGRIKDVSRAATLKLIWWLATEKVNLWVNWIHEHY*KSYCFW 496 CKP EEGG GL +K+ + LKLIW + + +LWV WI K FW Sbjct: 115 CKPKEEGGLGLRSLKEANDVCCLKLIWRIISHADSLWVKWIQSSLLKKVSFW 166 Score = 23.5 bits (49), Expect(2) = 8e-06 Identities = 10/28 (35%), Positives = 12/28 (42%) Frame = -1 Query: 406 IGKGDTVKFWLDPWSPMWYW*ESLGKTG 323 I G FW D WS + +S G G Sbjct: 197 INNGARTSFWYDDWSDLGRLIDSAGDRG 224