BLASTX nr result
ID: Cocculus22_contig00010049
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus22_contig00010049 (370 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002306967.2| hypothetical protein POPTR_0005s26950g [Popu... 55 8e-06 >ref|XP_002306967.2| hypothetical protein POPTR_0005s26950g [Populus trichocarpa] gi|550339821|gb|EEE93963.2| hypothetical protein POPTR_0005s26950g [Populus trichocarpa] Length = 174 Score = 55.5 bits (132), Expect = 8e-06 Identities = 32/68 (47%), Positives = 39/68 (57%), Gaps = 1/68 (1%) Frame = +3 Query: 168 DLVVKKREKKMITRSNLADQLREYETRXXXXXXXXXXXXXXXXXXXXRAD-VIFVIWELI 344 ++ K++ KMITRSNLADQLREY+ R R D V+FVIWEL Sbjct: 59 EIEAKRQTIKMITRSNLADQLREYQIRSKHDWASVSFFSSASNISSSRVDVVVFVIWELF 118 Query: 345 ILAFLVAS 368 I+AFLV S Sbjct: 119 IIAFLVFS 126