BLASTX nr result
ID: Cocculus22_contig00009829
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus22_contig00009829 (455 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB20714.1| ABC transporter A family member 2 [Morus notabilis] 60 2e-07 >gb|EXB20714.1| ABC transporter A family member 2 [Morus notabilis] Length = 856 Score = 60.5 bits (145), Expect = 2e-07 Identities = 27/32 (84%), Positives = 28/32 (87%) Frame = +3 Query: 162 DQRGLRYIYRNSTHQWSRTPI*LNDMDHDVDV 257 DQ GLRY YRNSTHQWSR PI LNDMDHDV+V Sbjct: 825 DQSGLRYNYRNSTHQWSRMPIQLNDMDHDVNV 856