BLASTX nr result
ID: Cocculus22_contig00009702
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus22_contig00009702 (729 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EJY66654.1| hypothetical protein OXYTRI_13059 [Oxytricha trif... 70 2e-15 gb|ENH98510.1| hypothetical protein COCC4DRAFT_155570 [Bipolaris... 74 5e-11 gb|EHK48568.1| hypothetical protein TRIATDRAFT_255346 [Trichoder... 72 1e-10 emb|CCW72292.1| unnamed protein product [Phytomonas sp. isolate ... 70 6e-10 emb|CCW65860.1| unnamed protein product [Phytomonas sp. isolate ... 70 6e-10 gb|EGZ04885.1| hypothetical protein PHYSODRAFT_291676 [Phytophth... 70 6e-10 ref|XP_003614391.1| Tar1p [Medicago truncatula] gi|355515726|gb|... 70 7e-10 ref|XP_007371709.1| hypothetical protein DICSQDRAFT_73523, parti... 70 1e-09 gb|EGN91453.1| hypothetical protein SERLA73DRAFT_67379 [Serpula ... 68 4e-09 ref|XP_007335665.1| hypothetical protein AGABI1DRAFT_49393, part... 67 6e-09 ref|XP_007413083.1| hypothetical protein MELLADRAFT_90060 [Melam... 65 2e-08 ref|XP_007413993.1| hypothetical protein MELLADRAFT_90623 [Melam... 65 2e-08 ref|XP_007414633.1| hypothetical protein MELLADRAFT_91703 [Melam... 65 2e-08 ref|XP_007415543.1| hypothetical protein MELLADRAFT_92712 [Melam... 65 2e-08 ref|XP_007417431.1| hypothetical protein MELLADRAFT_94729 [Melam... 65 2e-08 ref|XP_007417435.1| hypothetical protein MELLADRAFT_94733 [Melam... 65 2e-08 ref|XP_007405674.1| hypothetical protein MELLADRAFT_92520 [Melam... 65 2e-08 ref|XP_007419024.1| hypothetical protein MELLADRAFT_84532 [Melam... 65 2e-08 dbj|GAA47559.1| hypothetical protein CLF_100512 [Clonorchis sine... 60 6e-07 ref|XP_001698950.1| hypothetical protein CHLREDRAFT_155068 [Chla... 60 1e-06 >gb|EJY66654.1| hypothetical protein OXYTRI_13059 [Oxytricha trifallax] Length = 111 Score = 70.1 bits (170), Expect(2) = 2e-15 Identities = 28/38 (73%), Positives = 30/38 (78%) Frame = +3 Query: 12 PGPGSDYERFNCNNFNVRY*SWNYRGCWHQTCPLIVTR 125 P S+YE FNCNNFN+RY SWNYRGCWHQTCP I R Sbjct: 15 PSQKSNYELFNCNNFNIRYWSWNYRGCWHQTCPPIDPR 52 Score = 38.9 bits (89), Expect(2) = 2e-15 Identities = 18/28 (64%), Positives = 22/28 (78%) Frame = +1 Query: 214 LGTLRACCLP*KYEQFLRPTLQDRTLIL 297 LG LRACCLP ++ FLR L++RTLIL Sbjct: 81 LGNLRACCLPQMWQPFLRLPLRNRTLIL 108 >gb|ENH98510.1| hypothetical protein COCC4DRAFT_155570 [Bipolaris maydis ATCC 48331] gi|576911966|gb|EUC26718.1| hypothetical protein COCCADRAFT_42279 [Bipolaris zeicola 26-R-13] Length = 68 Score = 73.9 bits (180), Expect = 5e-11 Identities = 29/38 (76%), Positives = 31/38 (81%) Frame = +3 Query: 12 PGPGSDYERFNCNNFNVRY*SWNYRGCWHQTCPLIVTR 125 P P +YE FNCNNFN+RY SWNYRGCWHQTCP IV R Sbjct: 31 PDPSFNYELFNCNNFNIRYWSWNYRGCWHQTCPPIVPR 68 >gb|EHK48568.1| hypothetical protein TRIATDRAFT_255346 [Trichoderma atroviride IMI 206040] Length = 59 Score = 72.4 bits (176), Expect = 1e-10 Identities = 30/40 (75%), Positives = 32/40 (80%) Frame = +3 Query: 6 GIPGPGSDYERFNCNNFNVRY*SWNYRGCWHQTCPLIVTR 125 G PGP +YE FN NNFN+RY SWNYRGCWHQTCP IV R Sbjct: 20 GQPGPRFNYELFNHNNFNIRYWSWNYRGCWHQTCPPIVPR 59 >emb|CCW72292.1| unnamed protein product [Phytomonas sp. isolate Hart1] Length = 88 Score = 70.5 bits (171), Expect = 6e-10 Identities = 31/46 (67%), Positives = 35/46 (76%), Gaps = 1/46 (2%) Frame = +3 Query: 15 GPGSDYERFNCNNFNVRY*SWNYRGCWHQTCPLIVTRV-MDLN*PH 149 GP +YE FN N+ N+R+ SWNYRGCWHQTCP IVTR M LN PH Sbjct: 43 GPQFNYEPFNSNSINIRFWSWNYRGCWHQTCPPIVTRYWMGLNIPH 88 >emb|CCW65860.1| unnamed protein product [Phytomonas sp. isolate EM1] Length = 89 Score = 70.5 bits (171), Expect = 6e-10 Identities = 31/46 (67%), Positives = 35/46 (76%), Gaps = 1/46 (2%) Frame = +3 Query: 15 GPGSDYERFNCNNFNVRY*SWNYRGCWHQTCPLIVTRV-MDLN*PH 149 GP +YE FN N+ N+R+ SWNYRGCWHQTCP IVTR M LN PH Sbjct: 44 GPQFNYEPFNSNSINIRFWSWNYRGCWHQTCPPIVTRYWMGLNIPH 89 >gb|EGZ04885.1| hypothetical protein PHYSODRAFT_291676 [Phytophthora sojae] gi|348671639|gb|EGZ11460.1| hypothetical protein PHYSODRAFT_287468 [Phytophthora sojae] Length = 55 Score = 70.5 bits (171), Expect = 6e-10 Identities = 29/40 (72%), Positives = 31/40 (77%) Frame = +3 Query: 6 GIPGPGSDYERFNCNNFNVRY*SWNYRGCWHQTCPLIVTR 125 G P S+YE FNCNNFN+RY SWNYRGCWHQTCP I R Sbjct: 16 GHPKQKSNYELFNCNNFNIRYWSWNYRGCWHQTCPPIDPR 55 >ref|XP_003614391.1| Tar1p [Medicago truncatula] gi|355515726|gb|AES97349.1| Tar1p [Medicago truncatula] Length = 553 Score = 70.1 bits (170), Expect = 7e-10 Identities = 26/33 (78%), Positives = 28/33 (84%) Frame = +3 Query: 12 PGPGSDYERFNCNNFNVRY*SWNYRGCWHQTCP 110 P P S+YE FNCNN N+RY SWNYRGCWHQTCP Sbjct: 516 PNPRSNYELFNCNNLNIRYWSWNYRGCWHQTCP 548 >ref|XP_007371709.1| hypothetical protein DICSQDRAFT_73523, partial [Dichomitus squalens LYAD-421 SS1] gi|395323025|gb|EJF55554.1| hypothetical protein DICSQDRAFT_73523, partial [Dichomitus squalens LYAD-421 SS1] Length = 66 Score = 69.7 bits (169), Expect = 1e-09 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = +3 Query: 27 DYERFNCNNFNVRY*SWNYRGCWHQTCPLIVTR 125 +YE FNCNNFN+RY SWNYRGCWHQTCP IV R Sbjct: 34 NYELFNCNNFNIRYWSWNYRGCWHQTCPPIVPR 66 >gb|EGN91453.1| hypothetical protein SERLA73DRAFT_67379 [Serpula lacrymans var. lacrymans S7.3] Length = 80 Score = 67.8 bits (164), Expect = 4e-09 Identities = 26/33 (78%), Positives = 28/33 (84%) Frame = +3 Query: 27 DYERFNCNNFNVRY*SWNYRGCWHQTCPLIVTR 125 +YE FNCNNFN+ Y SWNYRGCWHQTCP IV R Sbjct: 48 NYELFNCNNFNIHYWSWNYRGCWHQTCPPIVPR 80 >ref|XP_007335665.1| hypothetical protein AGABI1DRAFT_49393, partial [Agaricus bisporus var. burnettii JB137-S8] gi|409072524|gb|EKM73697.1| hypothetical protein AGABI1DRAFT_49393, partial [Agaricus bisporus var. burnettii JB137-S8] Length = 73 Score = 67.0 bits (162), Expect = 6e-09 Identities = 26/33 (78%), Positives = 28/33 (84%) Frame = +3 Query: 27 DYERFNCNNFNVRY*SWNYRGCWHQTCPLIVTR 125 +Y FNCNNFN+RY SWNYRGCWHQTCP IV R Sbjct: 41 NYGLFNCNNFNIRYWSWNYRGCWHQTCPPIVPR 73 >ref|XP_007413083.1| hypothetical protein MELLADRAFT_90060 [Melampsora larici-populina 98AG31] gi|328854504|gb|EGG03636.1| hypothetical protein MELLADRAFT_90060 [Melampsora larici-populina 98AG31] Length = 87 Score = 65.1 bits (157), Expect = 2e-08 Identities = 26/33 (78%), Positives = 27/33 (81%) Frame = +3 Query: 27 DYERFNCNNFNVRY*SWNYRGCWHQTCPLIVTR 125 DYE FN NNFN+RY SWNYRGCWHQTCP I R Sbjct: 23 DYELFNVNNFNIRYWSWNYRGCWHQTCPPIDPR 55 >ref|XP_007413993.1| hypothetical protein MELLADRAFT_90623 [Melampsora larici-populina 98AG31] gi|328853743|gb|EGG02880.1| hypothetical protein MELLADRAFT_90623 [Melampsora larici-populina 98AG31] Length = 134 Score = 65.1 bits (157), Expect = 2e-08 Identities = 26/33 (78%), Positives = 27/33 (81%) Frame = +3 Query: 27 DYERFNCNNFNVRY*SWNYRGCWHQTCPLIVTR 125 DYE FN NNFN+RY SWNYRGCWHQTCP I R Sbjct: 70 DYELFNVNNFNIRYWSWNYRGCWHQTCPPIDPR 102 >ref|XP_007414633.1| hypothetical protein MELLADRAFT_91703 [Melampsora larici-populina 98AG31] gi|328852954|gb|EGG02096.1| hypothetical protein MELLADRAFT_91703 [Melampsora larici-populina 98AG31] Length = 71 Score = 65.1 bits (157), Expect = 2e-08 Identities = 26/33 (78%), Positives = 27/33 (81%) Frame = +3 Query: 27 DYERFNCNNFNVRY*SWNYRGCWHQTCPLIVTR 125 DYE FN NNFN+RY SWNYRGCWHQTCP I R Sbjct: 39 DYELFNVNNFNIRYWSWNYRGCWHQTCPPIDPR 71 >ref|XP_007415543.1| hypothetical protein MELLADRAFT_92712 [Melampsora larici-populina 98AG31] gi|328852044|gb|EGG01193.1| hypothetical protein MELLADRAFT_92712 [Melampsora larici-populina 98AG31] Length = 130 Score = 65.1 bits (157), Expect = 2e-08 Identities = 26/33 (78%), Positives = 27/33 (81%) Frame = +3 Query: 27 DYERFNCNNFNVRY*SWNYRGCWHQTCPLIVTR 125 DYE FN NNFN+RY SWNYRGCWHQTCP I R Sbjct: 66 DYELFNVNNFNIRYWSWNYRGCWHQTCPPIDPR 98 >ref|XP_007417431.1| hypothetical protein MELLADRAFT_94729 [Melampsora larici-populina 98AG31] gi|328850152|gb|EGF99321.1| hypothetical protein MELLADRAFT_94729 [Melampsora larici-populina 98AG31] Length = 113 Score = 65.1 bits (157), Expect = 2e-08 Identities = 26/33 (78%), Positives = 27/33 (81%) Frame = +3 Query: 27 DYERFNCNNFNVRY*SWNYRGCWHQTCPLIVTR 125 DYE FN NNFN+RY SWNYRGCWHQTCP I R Sbjct: 49 DYELFNVNNFNIRYWSWNYRGCWHQTCPPIDPR 81 >ref|XP_007417435.1| hypothetical protein MELLADRAFT_94733 [Melampsora larici-populina 98AG31] gi|328850149|gb|EGF99318.1| hypothetical protein MELLADRAFT_94733 [Melampsora larici-populina 98AG31] Length = 106 Score = 65.1 bits (157), Expect = 2e-08 Identities = 26/33 (78%), Positives = 27/33 (81%) Frame = +3 Query: 27 DYERFNCNNFNVRY*SWNYRGCWHQTCPLIVTR 125 DYE FN NNFN+RY SWNYRGCWHQTCP I R Sbjct: 42 DYELFNVNNFNIRYWSWNYRGCWHQTCPPIDPR 74 >ref|XP_007405674.1| hypothetical protein MELLADRAFT_92520 [Melampsora larici-populina 98AG31] gi|599406978|ref|XP_007413435.1| hypothetical protein MELLADRAFT_90342 [Melampsora larici-populina 98AG31] gi|599420165|ref|XP_007416289.1| hypothetical protein MELLADRAFT_93286 [Melampsora larici-populina 98AG31] gi|599426092|ref|XP_007417784.1| hypothetical protein MELLADRAFT_95029 [Melampsora larici-populina 98AG31] gi|328849783|gb|EGF98957.1| hypothetical protein MELLADRAFT_95029 [Melampsora larici-populina 98AG31] gi|328851287|gb|EGG00443.1| hypothetical protein MELLADRAFT_93286 [Melampsora larici-populina 98AG31] gi|328854166|gb|EGG03300.1| hypothetical protein MELLADRAFT_90342 [Melampsora larici-populina 98AG31] gi|328861970|gb|EGG11072.1| hypothetical protein MELLADRAFT_92520 [Melampsora larici-populina 98AG31] Length = 103 Score = 65.1 bits (157), Expect = 2e-08 Identities = 26/33 (78%), Positives = 27/33 (81%) Frame = +3 Query: 27 DYERFNCNNFNVRY*SWNYRGCWHQTCPLIVTR 125 DYE FN NNFN+RY SWNYRGCWHQTCP I R Sbjct: 39 DYELFNVNNFNIRYWSWNYRGCWHQTCPPIDPR 71 >ref|XP_007419024.1| hypothetical protein MELLADRAFT_84532 [Melampsora larici-populina 98AG31] gi|328848488|gb|EGF97701.1| hypothetical protein MELLADRAFT_84532 [Melampsora larici-populina 98AG31] Length = 146 Score = 65.1 bits (157), Expect = 2e-08 Identities = 26/33 (78%), Positives = 27/33 (81%) Frame = +3 Query: 27 DYERFNCNNFNVRY*SWNYRGCWHQTCPLIVTR 125 DYE FN NNFN+RY SWNYRGCWHQTCP I R Sbjct: 82 DYELFNVNNFNIRYWSWNYRGCWHQTCPPIDPR 114 >dbj|GAA47559.1| hypothetical protein CLF_100512 [Clonorchis sinensis] Length = 155 Score = 60.5 bits (145), Expect = 6e-07 Identities = 23/37 (62%), Positives = 29/37 (78%) Frame = +3 Query: 18 PGSDYERFNCNNFNVRY*SWNYRGCWHQTCPLIVTRV 128 P S+YE FNCNNFN+R+ SW+YRGCWHQT L + + Sbjct: 116 PRSNYELFNCNNFNIRFWSWSYRGCWHQTKSLTLYNI 152 >ref|XP_001698950.1| hypothetical protein CHLREDRAFT_155068 [Chlamydomonas reinhardtii] gi|158269841|gb|EDO95983.1| predicted protein [Chlamydomonas reinhardtii] Length = 87 Score = 59.7 bits (143), Expect = 1e-06 Identities = 21/24 (87%), Positives = 22/24 (91%) Frame = +3 Query: 39 FNCNNFNVRY*SWNYRGCWHQTCP 110 FNCNN N+RY SWNYRGCWHQTCP Sbjct: 59 FNCNNLNIRYWSWNYRGCWHQTCP 82