BLASTX nr result
ID: Cocculus22_contig00009541
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus22_contig00009541 (514 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002887590.1| expressed protein [Arabidopsis lyrata subsp.... 71 2e-10 ref|NP_001117603.1| conserved peptide upstream open reading fram... 69 9e-10 ref|XP_003544337.1| PREDICTED: uncharacterized protein LOC100799... 68 1e-09 ref|XP_004499194.1| PREDICTED: uncharacterized protein LOC101496... 67 2e-09 ref|XP_006473551.1| PREDICTED: uncharacterized protein LOC102624... 67 3e-09 ref|XP_004504309.1| PREDICTED: uncharacterized protein LOC101502... 67 3e-09 ref|XP_006340664.1| PREDICTED: uncharacterized protein LOC102593... 65 1e-08 ref|XP_006585165.1| PREDICTED: uncharacterized protein LOC102669... 64 3e-08 ref|XP_006362036.1| PREDICTED: uncharacterized protein LOC102590... 63 4e-08 ref|XP_004500982.1| PREDICTED: uncharacterized protein LOC101493... 63 4e-08 ref|NP_001118342.1| uncharacterized protein [Arabidopsis thalian... 62 6e-08 ref|XP_004248699.1| PREDICTED: uncharacterized protein LOC101260... 62 8e-08 ref|XP_004973272.1| PREDICTED: basic leucine zipper 9-like isofo... 61 1e-07 ref|XP_004289641.1| PREDICTED: uncharacterized protein LOC101313... 60 4e-07 ref|NP_001119115.1| conserved peptide upstream open reading fram... 60 4e-07 ref|XP_004507476.1| PREDICTED: uncharacterized protein LOC101515... 58 1e-06 ref|XP_004500792.1| PREDICTED: uncharacterized protein LOC101488... 57 3e-06 >ref|XP_002887590.1| expressed protein [Arabidopsis lyrata subsp. lyrata] gi|297333431|gb|EFH63849.1| expressed protein [Arabidopsis lyrata subsp. lyrata] Length = 53 Score = 70.9 bits (172), Expect = 2e-10 Identities = 32/42 (76%), Positives = 38/42 (90%) Frame = +2 Query: 317 FMSPILCEILLAGLMLDSTQRRRSHLVQSFSVVFLYWFYVFS 442 FMSP++ EIL +GL +DS+ RRR+HLVQSFSVVFLYWFYVFS Sbjct: 12 FMSPVISEILRSGLTIDSSLRRRTHLVQSFSVVFLYWFYVFS 53 >ref|NP_001117603.1| conserved peptide upstream open reading frame 5 [Arabidopsis thaliana] gi|332197591|gb|AEE35712.1| conserved peptide upstream open reading frame 5 [Arabidopsis thaliana] Length = 41 Score = 68.6 bits (166), Expect = 9e-10 Identities = 31/41 (75%), Positives = 37/41 (90%) Frame = +2 Query: 320 MSPILCEILLAGLMLDSTQRRRSHLVQSFSVVFLYWFYVFS 442 MSP++ EIL +GL +DS+ RRR+HLVQSFSVVFLYWFYVFS Sbjct: 1 MSPVISEILRSGLTIDSSLRRRTHLVQSFSVVFLYWFYVFS 41 >ref|XP_003544337.1| PREDICTED: uncharacterized protein LOC100799960 [Glycine max] gi|356564302|ref|XP_003550394.1| PREDICTED: uncharacterized protein LOC100799844 [Glycine max] gi|593795374|ref|XP_007160725.1| hypothetical protein PHAVU_001G011900g [Phaseolus vulgaris] gi|561034189|gb|ESW32719.1| hypothetical protein PHAVU_001G011900g [Phaseolus vulgaris] Length = 41 Score = 68.2 bits (165), Expect = 1e-09 Identities = 31/41 (75%), Positives = 37/41 (90%) Frame = +2 Query: 320 MSPILCEILLAGLMLDSTQRRRSHLVQSFSVVFLYWFYVFS 442 MSP+L EIL +G M++S+ RRR+HLVQSFSVVFLYWFYVFS Sbjct: 1 MSPVLSEILRSGFMINSSLRRRTHLVQSFSVVFLYWFYVFS 41 >ref|XP_004499194.1| PREDICTED: uncharacterized protein LOC101496764 [Cicer arietinum] Length = 41 Score = 67.4 bits (163), Expect = 2e-09 Identities = 30/41 (73%), Positives = 37/41 (90%) Frame = +2 Query: 320 MSPILCEILLAGLMLDSTQRRRSHLVQSFSVVFLYWFYVFS 442 MSP+L EIL +G ++DS+ +RR+HLVQSFSVVFLYWFYVFS Sbjct: 1 MSPVLSEILRSGFIIDSSLKRRTHLVQSFSVVFLYWFYVFS 41 >ref|XP_006473551.1| PREDICTED: uncharacterized protein LOC102624295 [Citrus sinensis] gi|590593628|ref|XP_007017623.1| Peptide upstream open reading frame 5 [Theobroma cacao] gi|508722951|gb|EOY14848.1| Peptide upstream open reading frame 5 [Theobroma cacao] Length = 41 Score = 67.0 bits (162), Expect = 3e-09 Identities = 30/41 (73%), Positives = 37/41 (90%) Frame = +2 Query: 320 MSPILCEILLAGLMLDSTQRRRSHLVQSFSVVFLYWFYVFS 442 MSP++ EIL +G M++S+ RRR+HLVQSFSVVFLYWFYVFS Sbjct: 1 MSPVVSEILRSGFMINSSLRRRTHLVQSFSVVFLYWFYVFS 41 >ref|XP_004504309.1| PREDICTED: uncharacterized protein LOC101502371 [Cicer arietinum] Length = 39 Score = 66.6 bits (161), Expect = 3e-09 Identities = 30/41 (73%), Positives = 37/41 (90%) Frame = +2 Query: 320 MSPILCEILLAGLMLDSTQRRRSHLVQSFSVVFLYWFYVFS 442 MSP++CEI +G M++ST RRR+HLVQSFSVVFLYWFY+FS Sbjct: 1 MSPVICEI--SGFMINSTLRRRTHLVQSFSVVFLYWFYIFS 39 >ref|XP_006340664.1| PREDICTED: uncharacterized protein LOC102593404 [Solanum tuberosum] Length = 41 Score = 64.7 bits (156), Expect = 1e-08 Identities = 28/41 (68%), Positives = 36/41 (87%) Frame = +2 Query: 320 MSPILCEILLAGLMLDSTQRRRSHLVQSFSVVFLYWFYVFS 442 M+P++ E+LL+G ++ST RR +HLVQSFSVVFLYWFYVFS Sbjct: 1 MTPVISEVLLSGFTINSTLRRGTHLVQSFSVVFLYWFYVFS 41 >ref|XP_006585165.1| PREDICTED: uncharacterized protein LOC102669679 [Glycine max] gi|593792796|ref|XP_007159437.1| hypothetical protein PHAVU_002G237700g [Phaseolus vulgaris] gi|561032852|gb|ESW31431.1| hypothetical protein PHAVU_002G237700g [Phaseolus vulgaris] Length = 42 Score = 63.5 bits (153), Expect = 3e-08 Identities = 28/40 (70%), Positives = 36/40 (90%) Frame = +2 Query: 323 SPILCEILLAGLMLDSTQRRRSHLVQSFSVVFLYWFYVFS 442 SP++ EILL+G ++S+ RRR+HLVQSFSVVFL+WFYVFS Sbjct: 3 SPVISEILLSGFTINSSLRRRTHLVQSFSVVFLHWFYVFS 42 >ref|XP_006362036.1| PREDICTED: uncharacterized protein LOC102590957 [Solanum tuberosum] Length = 41 Score = 63.2 bits (152), Expect = 4e-08 Identities = 29/41 (70%), Positives = 34/41 (82%) Frame = +2 Query: 320 MSPILCEILLAGLMLDSTQRRRSHLVQSFSVVFLYWFYVFS 442 MS IL E+ L+G M++ST RRR+HLVQSFSVVFLYWFY S Sbjct: 1 MSAILSELFLSGFMINSTYRRRTHLVQSFSVVFLYWFYFIS 41 >ref|XP_004500982.1| PREDICTED: uncharacterized protein LOC101493326 [Cicer arietinum] Length = 54 Score = 63.2 bits (152), Expect = 4e-08 Identities = 29/41 (70%), Positives = 36/41 (87%) Frame = +2 Query: 320 MSPILCEILLAGLMLDSTQRRRSHLVQSFSVVFLYWFYVFS 442 MS IL E LL+G +++S+ RRR+HLVQSFS+VFLYWFYVFS Sbjct: 1 MSTILSEFLLSGFIINSSFRRRTHLVQSFSLVFLYWFYVFS 41 >ref|NP_001118342.1| uncharacterized protein [Arabidopsis thaliana] gi|330251639|gb|AEC06733.1| uncharacterized protein AT2G18162 [Arabidopsis thaliana] Length = 41 Score = 62.4 bits (150), Expect = 6e-08 Identities = 28/38 (73%), Positives = 33/38 (86%) Frame = +2 Query: 320 MSPILCEILLAGLMLDSTQRRRSHLVQSFSVVFLYWFY 433 M+P+LCEILL+GL + S RR+HLVQSFSVVFLYWFY Sbjct: 1 MTPVLCEILLSGLTVKSALCRRTHLVQSFSVVFLYWFY 38 >ref|XP_004248699.1| PREDICTED: uncharacterized protein LOC101260774 [Solanum lycopersicum] Length = 41 Score = 62.0 bits (149), Expect = 8e-08 Identities = 29/41 (70%), Positives = 33/41 (80%) Frame = +2 Query: 320 MSPILCEILLAGLMLDSTQRRRSHLVQSFSVVFLYWFYVFS 442 MS IL E+ L G M++ST RRR+HLVQSFSVVFLYWFY S Sbjct: 1 MSAILNELFLCGFMINSTYRRRTHLVQSFSVVFLYWFYCIS 41 >ref|XP_004973272.1| PREDICTED: basic leucine zipper 9-like isoform X2 [Setaria italica] Length = 147 Score = 61.2 bits (147), Expect = 1e-07 Identities = 29/41 (70%), Positives = 34/41 (82%) Frame = +2 Query: 320 MSPILCEILLAGLMLDSTQRRRSHLVQSFSVVFLYWFYVFS 442 MS IL E +L+G M++ST RR +HLV SFSVVFLYWFYVFS Sbjct: 1 MSQILSEAILSGFMINSTLRRGTHLVLSFSVVFLYWFYVFS 41 >ref|XP_004289641.1| PREDICTED: uncharacterized protein LOC101313460 [Fragaria vesca subsp. vesca] Length = 41 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/41 (68%), Positives = 33/41 (80%) Frame = +2 Query: 320 MSPILCEILLAGLMLDSTQRRRSHLVQSFSVVFLYWFYVFS 442 MSP L E+LL+ M++ST RRR+HLVQSFSVVFLYW Y S Sbjct: 1 MSPTLSELLLSECMINSTYRRRTHLVQSFSVVFLYWLYYVS 41 >ref|NP_001119115.1| conserved peptide upstream open reading frame 2 [Arabidopsis thaliana] gi|332660996|gb|AEE86396.1| conserved peptide upstream open reading frame 2 [Arabidopsis thaliana] Length = 42 Score = 59.7 bits (143), Expect = 4e-07 Identities = 31/42 (73%), Positives = 34/42 (80%), Gaps = 1/42 (2%) Frame = +2 Query: 320 MSPI-LCEILLAGLMLDSTQRRRSHLVQSFSVVFLYWFYVFS 442 MSPI L EI L+G ML+ST RRR+HLVQSFSVVFLYW Y S Sbjct: 1 MSPIILSEIFLSGFMLNSTIRRRTHLVQSFSVVFLYWLYYVS 42 >ref|XP_004507476.1| PREDICTED: uncharacterized protein LOC101515270 [Cicer arietinum] gi|593267553|ref|XP_007135954.1| hypothetical protein PHAVU_009G005900g [Phaseolus vulgaris] gi|561009041|gb|ESW07948.1| hypothetical protein PHAVU_009G005900g [Phaseolus vulgaris] Length = 41 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/41 (65%), Positives = 31/41 (75%) Frame = +2 Query: 320 MSPILCEILLAGLMLDSTQRRRSHLVQSFSVVFLYWFYVFS 442 M PIL EI +G M++ST RRR+HLVQSFSV FLYW Y S Sbjct: 1 MYPILSEIFFSGCMINSTVRRRTHLVQSFSVAFLYWLYYVS 41 >ref|XP_004500792.1| PREDICTED: uncharacterized protein LOC101488322 [Cicer arietinum] Length = 41 Score = 56.6 bits (135), Expect = 3e-06 Identities = 27/41 (65%), Positives = 31/41 (75%) Frame = +2 Query: 320 MSPILCEILLAGLMLDSTQRRRSHLVQSFSVVFLYWFYVFS 442 M IL EI +G M++ST RRR+HLVQSFSVVFLYW Y S Sbjct: 1 MYQILSEIFFSGCMINSTVRRRTHLVQSFSVVFLYWLYYVS 41