BLASTX nr result
ID: Cocculus22_contig00009481
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus22_contig00009481 (560 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006447102.1| hypothetical protein CICLE_v10016522mg [Citr... 57 2e-06 >ref|XP_006447102.1| hypothetical protein CICLE_v10016522mg [Citrus clementina] gi|568831570|ref|XP_006470035.1| PREDICTED: uncharacterized protein At3g27210-like [Citrus sinensis] gi|557549713|gb|ESR60342.1| hypothetical protein CICLE_v10016522mg [Citrus clementina] Length = 233 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/49 (55%), Positives = 32/49 (65%) Frame = -1 Query: 560 SGANSTCGSERTPNIPKTGDEKLSRAVQCCLPSLGMSRSSIDRKKGLSP 414 SG NS C SERTPN ++K R+ QCCLPS R+S DRKK +SP Sbjct: 179 SGVNSVCSSERTPNGDSMMEDKPMRSAQCCLPSFVSCRNSTDRKKKMSP 227