BLASTX nr result
ID: Cocculus22_contig00008998
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus22_contig00008998 (379 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006850860.1| hypothetical protein AMTR_s00025p00142780 [A... 99 5e-19 ref|XP_007029495.1| Pentatricopeptide repeat-containing protein,... 96 5e-18 ref|XP_002275213.2| PREDICTED: pentatricopeptide repeat-containi... 96 7e-18 emb|CBI26569.3| unnamed protein product [Vitis vinifera] 96 7e-18 ref|XP_004249757.1| PREDICTED: pentatricopeptide repeat-containi... 95 1e-17 ref|XP_006351327.1| PREDICTED: pentatricopeptide repeat-containi... 94 1e-17 ref|XP_004164250.1| PREDICTED: putative pentatricopeptide repeat... 93 4e-17 ref|XP_004146932.1| PREDICTED: putative pentatricopeptide repeat... 93 4e-17 gb|EYU45363.1| hypothetical protein MIMGU_mgv1a022626mg [Mimulus... 89 6e-16 ref|XP_002519998.1| pentatricopeptide repeat-containing protein,... 88 1e-15 ref|NP_001174991.1| Os06g0710800 [Oryza sativa Japonica Group] g... 88 1e-15 ref|XP_006657333.1| PREDICTED: pentatricopeptide repeat-containi... 87 2e-15 ref|XP_006590461.1| PREDICTED: pentatricopeptide repeat-containi... 85 9e-15 ref|XP_006491815.1| PREDICTED: pentatricopeptide repeat-containi... 85 9e-15 ref|XP_006428506.1| hypothetical protein CICLE_v10011504mg [Citr... 85 9e-15 ref|XP_004966403.1| PREDICTED: pentatricopeptide repeat-containi... 84 2e-14 ref|XP_002437576.1| hypothetical protein SORBIDRAFT_10g029640 [S... 84 2e-14 ref|XP_006573837.1| PREDICTED: pentatricopeptide repeat-containi... 83 3e-14 gb|AFW69441.1| hypothetical protein ZEAMMB73_914225 [Zea mays] 82 8e-14 ref|XP_003563545.1| PREDICTED: pentatricopeptide repeat-containi... 82 8e-14 >ref|XP_006850860.1| hypothetical protein AMTR_s00025p00142780 [Amborella trichopoda] gi|548854531|gb|ERN12441.1| hypothetical protein AMTR_s00025p00142780 [Amborella trichopoda] Length = 416 Score = 99.4 bits (246), Expect = 5e-19 Identities = 46/60 (76%), Positives = 53/60 (88%) Frame = +3 Query: 15 GISPDVVTYTTLMKAFIRARKYDQVIGIYVEMESSGCTPDRKAREMLQTASLIIKQRHGH 194 G+SPDVVTY+TLMKAF RARK+DQV +Y EMES+GC PDRKAREMLQ A LI++QRHGH Sbjct: 355 GLSPDVVTYSTLMKAFFRARKFDQVQEVYKEMESAGCVPDRKAREMLQNALLILEQRHGH 414 >ref|XP_007029495.1| Pentatricopeptide repeat-containing protein, putative isoform 1 [Theobroma cacao] gi|508718100|gb|EOY09997.1| Pentatricopeptide repeat-containing protein, putative isoform 1 [Theobroma cacao] Length = 513 Score = 95.9 bits (237), Expect = 5e-18 Identities = 44/58 (75%), Positives = 54/58 (93%) Frame = +3 Query: 15 GISPDVVTYTTLMKAFIRARKYDQVIGIYVEMESSGCTPDRKAREMLQTASLIIKQRH 188 GISPDV+TY+TLMKAFIRA+K+D+V IY EMESSGCTPDRKAR+MLQTA ++++QRH Sbjct: 456 GISPDVITYSTLMKAFIRAKKFDRVPEIYREMESSGCTPDRKARQMLQTALMVLEQRH 513 >ref|XP_002275213.2| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial-like [Vitis vinifera] Length = 494 Score = 95.5 bits (236), Expect = 7e-18 Identities = 46/58 (79%), Positives = 53/58 (91%) Frame = +3 Query: 15 GISPDVVTYTTLMKAFIRARKYDQVIGIYVEMESSGCTPDRKAREMLQTASLIIKQRH 188 GISPDVVTY+TLMKA IRARK+D+V IY EMES+GCTPDRKAREMLQTA L+++QRH Sbjct: 403 GISPDVVTYSTLMKACIRARKFDKVPEIYEEMESAGCTPDRKAREMLQTALLVLQQRH 460 >emb|CBI26569.3| unnamed protein product [Vitis vinifera] Length = 392 Score = 95.5 bits (236), Expect = 7e-18 Identities = 46/58 (79%), Positives = 53/58 (91%) Frame = +3 Query: 15 GISPDVVTYTTLMKAFIRARKYDQVIGIYVEMESSGCTPDRKAREMLQTASLIIKQRH 188 GISPDVVTY+TLMKA IRARK+D+V IY EMES+GCTPDRKAREMLQTA L+++QRH Sbjct: 324 GISPDVVTYSTLMKACIRARKFDKVPEIYEEMESAGCTPDRKAREMLQTALLVLQQRH 381 >ref|XP_004249757.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial-like [Solanum lycopersicum] Length = 523 Score = 94.7 bits (234), Expect = 1e-17 Identities = 43/58 (74%), Positives = 54/58 (93%) Frame = +3 Query: 15 GISPDVVTYTTLMKAFIRARKYDQVIGIYVEMESSGCTPDRKAREMLQTASLIIKQRH 188 GI+PDV+TY+TLMKAF+RA+K+DQV IY EMES+GCTPDRKAREMLQ+A +I++QRH Sbjct: 465 GITPDVITYSTLMKAFLRAKKFDQVPKIYSEMESTGCTPDRKAREMLQSALMILEQRH 522 >ref|XP_006351327.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial-like isoform X1 [Solanum tuberosum] gi|565369409|ref|XP_006351328.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial-like isoform X2 [Solanum tuberosum] gi|565369411|ref|XP_006351329.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial-like isoform X3 [Solanum tuberosum] Length = 523 Score = 94.4 bits (233), Expect = 1e-17 Identities = 43/58 (74%), Positives = 54/58 (93%) Frame = +3 Query: 15 GISPDVVTYTTLMKAFIRARKYDQVIGIYVEMESSGCTPDRKAREMLQTASLIIKQRH 188 GI+PDV+TY+TLMKAF+RA+K+DQV IY EMES+GCTPDRKAREMLQ+A +I++QRH Sbjct: 465 GITPDVITYSTLMKAFMRAKKFDQVPKIYSEMESTGCTPDRKAREMLQSALMILEQRH 522 >ref|XP_004164250.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g36300-like [Cucumis sativus] Length = 433 Score = 92.8 bits (229), Expect = 4e-17 Identities = 43/60 (71%), Positives = 54/60 (90%) Frame = +3 Query: 9 LKGISPDVVTYTTLMKAFIRARKYDQVIGIYVEMESSGCTPDRKAREMLQTASLIIKQRH 188 +KGISPDV+TYTTLMKAFIRA+K+ +V IY EMES+GCTPDRKAREML++ + I++QRH Sbjct: 325 VKGISPDVITYTTLMKAFIRAKKFAKVPEIYKEMESAGCTPDRKAREMLKSVTAILEQRH 384 >ref|XP_004146932.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g36300-like [Cucumis sativus] Length = 455 Score = 92.8 bits (229), Expect = 4e-17 Identities = 43/60 (71%), Positives = 54/60 (90%) Frame = +3 Query: 9 LKGISPDVVTYTTLMKAFIRARKYDQVIGIYVEMESSGCTPDRKAREMLQTASLIIKQRH 188 +KGISPDV+TYTTLMKAFIRA+K+ +V IY EMES+GCTPDRKAREML++ + I++QRH Sbjct: 325 VKGISPDVITYTTLMKAFIRAKKFAKVPEIYKEMESAGCTPDRKAREMLKSVTAILEQRH 384 >gb|EYU45363.1| hypothetical protein MIMGU_mgv1a022626mg [Mimulus guttatus] Length = 432 Score = 89.0 bits (219), Expect = 6e-16 Identities = 42/62 (67%), Positives = 54/62 (87%) Frame = +3 Query: 3 MLLKGISPDVVTYTTLMKAFIRARKYDQVIGIYVEMESSGCTPDRKAREMLQTASLIIKQ 182 +L GISPDVVTY+TLMKAF+ A+K+DQV IY EME+SGC+PDRKAREML++A + ++Q Sbjct: 371 ILESGISPDVVTYSTLMKAFLWAKKFDQVPKIYSEMEASGCSPDRKAREMLKSALIALEQ 430 Query: 183 RH 188 RH Sbjct: 431 RH 432 >ref|XP_002519998.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223540762|gb|EEF42322.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 498 Score = 88.2 bits (217), Expect = 1e-15 Identities = 41/58 (70%), Positives = 52/58 (89%) Frame = +3 Query: 15 GISPDVVTYTTLMKAFIRARKYDQVIGIYVEMESSGCTPDRKAREMLQTASLIIKQRH 188 GISPDVVTY+TLMKA+IRARK+D+V IY EMESSGCTPD+KARE+LQ A +++ +R+ Sbjct: 401 GISPDVVTYSTLMKAYIRARKFDEVPEIYSEMESSGCTPDKKAREILQAALMVLGRRN 458 >ref|NP_001174991.1| Os06g0710800 [Oryza sativa Japonica Group] gi|53792631|dbj|BAD53645.1| putative crp1 protein [Oryza sativa Japonica Group] gi|215693375|dbj|BAG88757.1| unnamed protein product [Oryza sativa Japonica Group] gi|255677390|dbj|BAH93719.1| Os06g0710800 [Oryza sativa Japonica Group] Length = 492 Score = 87.8 bits (216), Expect = 1e-15 Identities = 39/57 (68%), Positives = 51/57 (89%) Frame = +3 Query: 15 GISPDVVTYTTLMKAFIRARKYDQVIGIYVEMESSGCTPDRKAREMLQTASLIIKQR 185 G+SPDVVTYTTLMKAF+RA+K+++V +Y EME +GCTPDRKAREML AS++++QR Sbjct: 431 GMSPDVVTYTTLMKAFMRAKKFEKVSEVYKEMEGAGCTPDRKAREMLNDASIVLEQR 487 >ref|XP_006657333.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial-like, partial [Oryza brachyantha] Length = 389 Score = 87.4 bits (215), Expect = 2e-15 Identities = 41/57 (71%), Positives = 50/57 (87%) Frame = +3 Query: 15 GISPDVVTYTTLMKAFIRARKYDQVIGIYVEMESSGCTPDRKAREMLQTASLIIKQR 185 G+SPDVVTYTTLMKAF+RA+K+++V IY EME +GCTPDRKAREML AS I++QR Sbjct: 330 GMSPDVVTYTTLMKAFMRAKKFEKVSDIYKEMERAGCTPDRKAREMLNDASAILEQR 386 >ref|XP_006590461.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial-like [Glycine max] Length = 414 Score = 85.1 bits (209), Expect = 9e-15 Identities = 39/56 (69%), Positives = 49/56 (87%) Frame = +3 Query: 15 GISPDVVTYTTLMKAFIRARKYDQVIGIYVEMESSGCTPDRKAREMLQTASLIIKQ 182 G+SPDVVTYTTLMKAFIRA+K+D+V IY EME+ GCTPDRKAR+MLQ A ++++ Sbjct: 356 GVSPDVVTYTTLMKAFIRAKKFDEVPIIYKEMENDGCTPDRKARQMLQVALTVLER 411 >ref|XP_006491815.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial-like isoform X1 [Citrus sinensis] Length = 514 Score = 85.1 bits (209), Expect = 9e-15 Identities = 39/57 (68%), Positives = 52/57 (91%) Frame = +3 Query: 15 GISPDVVTYTTLMKAFIRARKYDQVIGIYVEMESSGCTPDRKAREMLQTASLIIKQR 185 GISPD+VTY+TLMKAFIRA+K+ +V IY +MESSGCTPDRKAR++LQ+A ++++QR Sbjct: 457 GISPDLVTYSTLMKAFIRAKKFHKVPEIYKQMESSGCTPDRKARQILQSALVVLEQR 513 >ref|XP_006428506.1| hypothetical protein CICLE_v10011504mg [Citrus clementina] gi|567871835|ref|XP_006428507.1| hypothetical protein CICLE_v10011504mg [Citrus clementina] gi|557530563|gb|ESR41746.1| hypothetical protein CICLE_v10011504mg [Citrus clementina] gi|557530564|gb|ESR41747.1| hypothetical protein CICLE_v10011504mg [Citrus clementina] Length = 514 Score = 85.1 bits (209), Expect = 9e-15 Identities = 39/57 (68%), Positives = 52/57 (91%) Frame = +3 Query: 15 GISPDVVTYTTLMKAFIRARKYDQVIGIYVEMESSGCTPDRKAREMLQTASLIIKQR 185 GISPD+VTY+TLMKAFIRA+K+ +V IY +MESSGCTPDRKAR++LQ+A ++++QR Sbjct: 457 GISPDLVTYSTLMKAFIRAKKFHKVPEIYKQMESSGCTPDRKARQILQSALVVLEQR 513 >ref|XP_004966403.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial-like isoform X1 [Setaria italica] gi|514768098|ref|XP_004966404.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial-like isoform X2 [Setaria italica] gi|514768101|ref|XP_004966405.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial-like isoform X3 [Setaria italica] Length = 493 Score = 84.3 bits (207), Expect = 2e-14 Identities = 38/57 (66%), Positives = 49/57 (85%) Frame = +3 Query: 15 GISPDVVTYTTLMKAFIRARKYDQVIGIYVEMESSGCTPDRKAREMLQTASLIIKQR 185 G+SPDVVTYTTLMK F+RA+K+++V +Y +ME GCTPDRKAREML AS+I++QR Sbjct: 433 GMSPDVVTYTTLMKTFMRAKKFEKVSEVYKDMERDGCTPDRKAREMLHDASVILEQR 489 >ref|XP_002437576.1| hypothetical protein SORBIDRAFT_10g029640 [Sorghum bicolor] gi|241915799|gb|EER88943.1| hypothetical protein SORBIDRAFT_10g029640 [Sorghum bicolor] Length = 429 Score = 84.0 bits (206), Expect = 2e-14 Identities = 37/57 (64%), Positives = 50/57 (87%) Frame = +3 Query: 15 GISPDVVTYTTLMKAFIRARKYDQVIGIYVEMESSGCTPDRKAREMLQTASLIIKQR 185 G+SPDVVTYTTLMK F+RA+K+++V +Y EME +GCTPDRKAREML A+++++QR Sbjct: 355 GMSPDVVTYTTLMKTFMRAKKFEKVSEVYREMERAGCTPDRKAREMLHDATVVLEQR 411 >ref|XP_006573837.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial-like isoform X1 [Glycine max] gi|571436687|ref|XP_006573838.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial-like isoform X2 [Glycine max] gi|571436689|ref|XP_006573839.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial-like isoform X3 [Glycine max] Length = 523 Score = 83.2 bits (204), Expect = 3e-14 Identities = 38/56 (67%), Positives = 49/56 (87%) Frame = +3 Query: 15 GISPDVVTYTTLMKAFIRARKYDQVIGIYVEMESSGCTPDRKAREMLQTASLIIKQ 182 G+SPDVVTYTTLMKAFIRA+K+D+V IY EME+ CTPDRKAR+MLQ A +++++ Sbjct: 461 GVSPDVVTYTTLMKAFIRAKKFDEVPIIYKEMENDRCTPDRKARQMLQVALMVLER 516 >gb|AFW69441.1| hypothetical protein ZEAMMB73_914225 [Zea mays] Length = 504 Score = 82.0 bits (201), Expect = 8e-14 Identities = 36/57 (63%), Positives = 49/57 (85%) Frame = +3 Query: 15 GISPDVVTYTTLMKAFIRARKYDQVIGIYVEMESSGCTPDRKAREMLQTASLIIKQR 185 G+SPDVVTYTTLMK F+RA+K+++V +Y EME +GC PDRKAREML A+++++QR Sbjct: 433 GMSPDVVTYTTLMKTFMRAKKFEKVSEVYREMERAGCAPDRKAREMLHDATVVLEQR 489 >ref|XP_003563545.1| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial-like [Brachypodium distachyon] Length = 492 Score = 82.0 bits (201), Expect = 8e-14 Identities = 37/57 (64%), Positives = 48/57 (84%) Frame = +3 Query: 15 GISPDVVTYTTLMKAFIRARKYDQVIGIYVEMESSGCTPDRKAREMLQTASLIIKQR 185 G+SPDVVTYTTLMK F+R +K+++V +Y EME +GCTPDRKAREML AS+ ++QR Sbjct: 433 GMSPDVVTYTTLMKGFMRVKKFEKVSEVYNEMERAGCTPDRKAREMLHDASVTLEQR 489