BLASTX nr result
ID: Cocculus22_contig00008777
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus22_contig00008777 (312 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_173419.1| hypothetical protein NitaMp077 [Nicotiana tabac... 93 3e-23 emb|CBI35735.3| unnamed protein product [Vitis vinifera] 69 6e-13 ref|XP_006401948.1| hypothetical protein EUTSA_v10015055mg [Eutr... 75 9e-12 ref|XP_002534684.1| conserved hypothetical protein [Ricinus comm... 56 3e-06 >ref|YP_173419.1| hypothetical protein NitaMp077 [Nicotiana tabacum] gi|56806582|dbj|BAD83483.1| hypothetical protein (mitochondrion) [Nicotiana tabacum] Length = 104 Score = 92.8 bits (229), Expect(2) = 3e-23 Identities = 46/50 (92%), Positives = 47/50 (94%) Frame = -2 Query: 164 FLLIQYNRGKDRTVPYRDNRPLSTDPPRAGHTSSVRLSRGGNRTTGKDPA 15 FLLIQYNRGKDRTVPYRD LSTDPPRAG+TSSVRLSRGGNRTTGKDPA Sbjct: 24 FLLIQYNRGKDRTVPYRDK--LSTDPPRAGNTSSVRLSRGGNRTTGKDPA 71 Score = 41.6 bits (96), Expect(2) = 3e-23 Identities = 21/24 (87%), Positives = 21/24 (87%) Frame = -3 Query: 232 MEVRARPRSILDQTIGGRSTYLSF 161 MEV ARPRSILDQTIGGRST L F Sbjct: 1 MEVGARPRSILDQTIGGRSTDLFF 24 >emb|CBI35735.3| unnamed protein product [Vitis vinifera] Length = 234 Score = 68.9 bits (167), Expect(2) = 6e-13 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = +1 Query: 1 ALGGSAGSFPVVLFPPRERRTEEVCPARGGSVES 102 ALG SAGSFP+VLFPPRERRTEEVCPARGGSVES Sbjct: 44 ALGRSAGSFPIVLFPPRERRTEEVCPARGGSVES 77 Score = 30.4 bits (67), Expect(2) = 6e-13 Identities = 11/13 (84%), Positives = 11/13 (84%) Frame = +2 Query: 107 CCLGREQYDLFPY 145 CCL RE YDLFPY Sbjct: 79 CCLSRELYDLFPY 91 >ref|XP_006401948.1| hypothetical protein EUTSA_v10015055mg [Eutrema salsugineum] gi|557103038|gb|ESQ43401.1| hypothetical protein EUTSA_v10015055mg [Eutrema salsugineum] Length = 114 Score = 75.1 bits (183), Expect = 9e-12 Identities = 39/46 (84%), Positives = 40/46 (86%), Gaps = 3/46 (6%) Frame = -2 Query: 311 TEQVREIGPAPLS*KQGPLREVKPRTYGSQGSSPVNIGSN---NRG 183 TEQVREIGPAPL KQGPLREVKPRTYGS+ SSPVNIGSN NRG Sbjct: 61 TEQVREIGPAPLYKKQGPLREVKPRTYGSRDSSPVNIGSNKTSNRG 106 >ref|XP_002534684.1| conserved hypothetical protein [Ricinus communis] gi|223524768|gb|EEF27698.1| conserved hypothetical protein [Ricinus communis] Length = 261 Score = 55.8 bits (133), Expect(2) = 3e-06 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +2 Query: 23 LSLLFCSRHEKDARKRYAQRAEDPLRV 103 LSLLFC RHEKDARKRYAQRAEDPLRV Sbjct: 67 LSLLFCFRHEKDARKRYAQRAEDPLRV 93 Score = 20.8 bits (42), Expect(2) = 3e-06 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = +1 Query: 1 ALGGSAGSFPVVLF 42 ALG SAGSF +LF Sbjct: 58 ALGRSAGSFLSLLF 71