BLASTX nr result
ID: Cocculus22_contig00008748
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus22_contig00008748 (896 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007210434.1| hypothetical protein PRUPE_ppa000205mg [Prun... 59 3e-06 >ref|XP_007210434.1| hypothetical protein PRUPE_ppa000205mg [Prunus persica] gi|462406169|gb|EMJ11633.1| hypothetical protein PRUPE_ppa000205mg [Prunus persica] Length = 1470 Score = 58.5 bits (140), Expect = 3e-06 Identities = 33/63 (52%), Positives = 44/63 (69%), Gaps = 1/63 (1%) Frame = -2 Query: 868 NDGE-VRKELQCTADSSKSADLPQPEHQPSPKNVDGNEGEPEAQKYVSLQDLSGSREEKH 692 +DG+ + KELQCTADSSK + LPQPE PSP+ + N+ + + QKY SLQ LS R + + Sbjct: 1281 SDGDDIGKELQCTADSSKVSALPQPE-DPSPRYIQDNQ-DADVQKYASLQALSVPRNDVN 1338 Query: 691 SGS 683 GS Sbjct: 1339 GGS 1341