BLASTX nr result
ID: Cocculus22_contig00008726
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus22_contig00008726 (269 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006848653.1| hypothetical protein AMTR_s00171p00059960 [A... 96 4e-18 ref|XP_004288209.1| PREDICTED: pentatricopeptide repeat-containi... 94 2e-17 ref|XP_006482334.1| PREDICTED: pentatricopeptide repeat-containi... 94 2e-17 ref|XP_006430873.1| hypothetical protein CICLE_v10011342mg [Citr... 94 2e-17 emb|CBI16890.3| unnamed protein product [Vitis vinifera] 93 3e-17 ref|XP_002279045.1| PREDICTED: pentatricopeptide repeat-containi... 93 3e-17 ref|XP_007208255.1| hypothetical protein PRUPE_ppa016546mg [Prun... 91 1e-16 emb|CAN75614.1| hypothetical protein VITISV_022293 [Vitis vinifera] 91 2e-16 ref|XP_007133767.1| hypothetical protein PHAVU_011G207300g [Phas... 89 6e-16 ref|XP_006594401.1| PREDICTED: pentatricopeptide repeat-containi... 87 2e-15 ref|XP_006594395.1| PREDICTED: pentatricopeptide repeat-containi... 87 2e-15 ref|XP_003545840.1| PREDICTED: pentatricopeptide repeat-containi... 87 2e-15 ref|XP_004140465.1| PREDICTED: pentatricopeptide repeat-containi... 85 1e-14 ref|XP_002532893.1| pentatricopeptide repeat-containing protein,... 85 1e-14 ref|XP_006340477.1| PREDICTED: pentatricopeptide repeat-containi... 84 2e-14 ref|XP_004237507.1| PREDICTED: pentatricopeptide repeat-containi... 82 6e-14 ref|XP_003627859.1| Pentatricopeptide repeat-containing protein ... 82 1e-13 ref|XP_004511038.1| PREDICTED: pentatricopeptide repeat-containi... 81 2e-13 ref|XP_006373499.1| hypothetical protein POPTR_0017s14300g [Popu... 80 2e-13 ref|XP_007033427.1| Tetratricopeptide repeat (TPR)-like superfam... 79 7e-13 >ref|XP_006848653.1| hypothetical protein AMTR_s00171p00059960 [Amborella trichopoda] gi|548852004|gb|ERN10234.1| hypothetical protein AMTR_s00171p00059960 [Amborella trichopoda] Length = 261 Score = 96.3 bits (238), Expect = 4e-18 Identities = 47/89 (52%), Positives = 61/89 (68%) Frame = -2 Query: 268 FTPTTMNQIXXXXXXXXXXXXXXFKWAESIPHYKHSLQPSWTMVHVLVGQKQFKAAQNLL 89 FT T +N I FKW ESIP+YKHS+QP WTM+H+L KQ+ AQ+L+ Sbjct: 38 FTNTMVNSILSNLSSDSLASWSFFKWVESIPNYKHSVQPYWTMIHILTKNKQYNIAQSLV 97 Query: 88 ERIAFKDFLSSPSVLNALICSHNDPVSNS 2 +RI F++FLSSPSVLNAL+ S +D +SNS Sbjct: 98 KRIMFREFLSSPSVLNALLNSCSDAISNS 126 >ref|XP_004288209.1| PREDICTED: pentatricopeptide repeat-containing protein At5g38730-like [Fragaria vesca subsp. vesca] Length = 589 Score = 94.4 bits (233), Expect = 2e-17 Identities = 44/65 (67%), Positives = 52/65 (80%) Frame = -2 Query: 196 KWAESIPHYKHSLQPSWTMVHVLVGQKQFKAAQNLLERIAFKDFLSSPSVLNALICSHND 17 KWAES+P+YKHSLQ SWTMVH+L + FK A LE+IAF+DFLSSPSVLNALI + +D Sbjct: 65 KWAESLPNYKHSLQCSWTMVHILTKHRHFKTAHQFLEKIAFRDFLSSPSVLNALIPTQDD 124 Query: 16 PVSNS 2 P NS Sbjct: 125 PDVNS 129 >ref|XP_006482334.1| PREDICTED: pentatricopeptide repeat-containing protein At5g38730-like [Citrus sinensis] Length = 592 Score = 94.0 bits (232), Expect = 2e-17 Identities = 43/66 (65%), Positives = 54/66 (81%), Gaps = 1/66 (1%) Frame = -2 Query: 196 KWAES-IPHYKHSLQPSWTMVHVLVGQKQFKAAQNLLERIAFKDFLSSPSVLNALICSHN 20 KWAES +P+YKHSLQ WTM+H+L K FK+AQN+LE+IA +DFLS+PSVLNAL+ H+ Sbjct: 66 KWAESAVPNYKHSLQSHWTMIHILTKNKHFKSAQNMLEKIALRDFLSTPSVLNALVKIHD 125 Query: 19 DPVSNS 2 DP NS Sbjct: 126 DPDGNS 131 >ref|XP_006430873.1| hypothetical protein CICLE_v10011342mg [Citrus clementina] gi|557532930|gb|ESR44113.1| hypothetical protein CICLE_v10011342mg [Citrus clementina] Length = 592 Score = 94.0 bits (232), Expect = 2e-17 Identities = 43/66 (65%), Positives = 54/66 (81%), Gaps = 1/66 (1%) Frame = -2 Query: 196 KWAES-IPHYKHSLQPSWTMVHVLVGQKQFKAAQNLLERIAFKDFLSSPSVLNALICSHN 20 KWAES +P+YKHSLQ WTM+H+L K FK+AQN+LE+IA +DFLS+PSVLNAL+ H+ Sbjct: 66 KWAESAVPNYKHSLQSHWTMIHILTKNKHFKSAQNMLEKIALRDFLSTPSVLNALVKIHD 125 Query: 19 DPVSNS 2 DP NS Sbjct: 126 DPDGNS 131 >emb|CBI16890.3| unnamed protein product [Vitis vinifera] Length = 653 Score = 93.2 bits (230), Expect = 3e-17 Identities = 44/65 (67%), Positives = 52/65 (80%) Frame = -2 Query: 196 KWAESIPHYKHSLQPSWTMVHVLVGQKQFKAAQNLLERIAFKDFLSSPSVLNALICSHND 17 KW ES ++KHSLQ SWTM+H L KQFK AQNLLERIA +D+LSSPSVLNA++ H+D Sbjct: 88 KWVESNLNHKHSLQSSWTMIHTLAKHKQFKTAQNLLERIAVRDYLSSPSVLNAVVRIHDD 147 Query: 16 PVSNS 2 P SNS Sbjct: 148 PDSNS 152 >ref|XP_002279045.1| PREDICTED: pentatricopeptide repeat-containing protein At5g38730-like [Vitis vinifera] Length = 590 Score = 93.2 bits (230), Expect = 3e-17 Identities = 44/65 (67%), Positives = 52/65 (80%) Frame = -2 Query: 196 KWAESIPHYKHSLQPSWTMVHVLVGQKQFKAAQNLLERIAFKDFLSSPSVLNALICSHND 17 KW ES ++KHSLQ SWTM+H L KQFK AQNLLERIA +D+LSSPSVLNA++ H+D Sbjct: 63 KWVESNLNHKHSLQSSWTMIHTLAKHKQFKTAQNLLERIAVRDYLSSPSVLNAVVRIHDD 122 Query: 16 PVSNS 2 P SNS Sbjct: 123 PDSNS 127 >ref|XP_007208255.1| hypothetical protein PRUPE_ppa016546mg [Prunus persica] gi|462403897|gb|EMJ09454.1| hypothetical protein PRUPE_ppa016546mg [Prunus persica] Length = 589 Score = 91.3 bits (225), Expect = 1e-16 Identities = 43/65 (66%), Positives = 49/65 (75%) Frame = -2 Query: 196 KWAESIPHYKHSLQPSWTMVHVLVGQKQFKAAQNLLERIAFKDFLSSPSVLNALICSHND 17 KW +SIP YKHSLQ WTM+H+L K FK AQ LLE+IAFKDFLSSP VLNAL+ +D Sbjct: 65 KWVQSIPTYKHSLQCCWTMIHILTEHKHFKPAQQLLEKIAFKDFLSSPMVLNALVPIQDD 124 Query: 16 PVSNS 2 P NS Sbjct: 125 PEVNS 129 >emb|CAN75614.1| hypothetical protein VITISV_022293 [Vitis vinifera] Length = 590 Score = 90.9 bits (224), Expect = 2e-16 Identities = 43/65 (66%), Positives = 51/65 (78%) Frame = -2 Query: 196 KWAESIPHYKHSLQPSWTMVHVLVGQKQFKAAQNLLERIAFKDFLSSPSVLNALICSHND 17 KW ES ++ HSLQ SWTM+H L KQFK AQNLLERIA +D+LSSPSVLNA++ H+D Sbjct: 63 KWVESNLNHXHSLQSSWTMIHTLAKHKQFKTAQNLLERIAVRDYLSSPSVLNAVVRIHDD 122 Query: 16 PVSNS 2 P SNS Sbjct: 123 PDSNS 127 >ref|XP_007133767.1| hypothetical protein PHAVU_011G207300g [Phaseolus vulgaris] gi|593263178|ref|XP_007133768.1| hypothetical protein PHAVU_011G207300g [Phaseolus vulgaris] gi|593263180|ref|XP_007133769.1| hypothetical protein PHAVU_011G207300g [Phaseolus vulgaris] gi|561006767|gb|ESW05761.1| hypothetical protein PHAVU_011G207300g [Phaseolus vulgaris] gi|561006768|gb|ESW05762.1| hypothetical protein PHAVU_011G207300g [Phaseolus vulgaris] gi|561006769|gb|ESW05763.1| hypothetical protein PHAVU_011G207300g [Phaseolus vulgaris] Length = 587 Score = 89.0 bits (219), Expect = 6e-16 Identities = 39/65 (60%), Positives = 50/65 (76%) Frame = -2 Query: 196 KWAESIPHYKHSLQPSWTMVHVLVGQKQFKAAQNLLERIAFKDFLSSPSVLNALICSHND 17 KW +SIPHY HSLQ SW M+H+L K FK AQN+LE+IA +DFL SPSVL+ L+ +H++ Sbjct: 62 KWLDSIPHYSHSLQCSWAMIHILTEHKHFKTAQNMLEKIANRDFLPSPSVLSTLVRTHDN 121 Query: 16 PVSNS 2 P NS Sbjct: 122 PEVNS 126 >ref|XP_006594401.1| PREDICTED: pentatricopeptide repeat-containing protein At5g38730-like isoform X7 [Glycine max] Length = 542 Score = 87.4 bits (215), Expect = 2e-15 Identities = 39/65 (60%), Positives = 49/65 (75%) Frame = -2 Query: 196 KWAESIPHYKHSLQPSWTMVHVLVGQKQFKAAQNLLERIAFKDFLSSPSVLNALICSHND 17 KW +SIPHY HSLQ SW M+H+L K FK AQ++LE+IA KDFLSSPSVL L+ +H++ Sbjct: 62 KWLDSIPHYSHSLQCSWAMIHILTEHKHFKTAQHMLEKIAHKDFLSSPSVLTTLVRTHDN 121 Query: 16 PVSNS 2 NS Sbjct: 122 QEVNS 126 >ref|XP_006594395.1| PREDICTED: pentatricopeptide repeat-containing protein At5g38730-like isoform X1 [Glycine max] gi|571499072|ref|XP_006594396.1| PREDICTED: pentatricopeptide repeat-containing protein At5g38730-like isoform X2 [Glycine max] gi|571499074|ref|XP_006594397.1| PREDICTED: pentatricopeptide repeat-containing protein At5g38730-like isoform X3 [Glycine max] gi|571499076|ref|XP_006594398.1| PREDICTED: pentatricopeptide repeat-containing protein At5g38730-like isoform X4 [Glycine max] gi|571499078|ref|XP_006594399.1| PREDICTED: pentatricopeptide repeat-containing protein At5g38730-like isoform X5 [Glycine max] gi|571499080|ref|XP_006594400.1| PREDICTED: pentatricopeptide repeat-containing protein At5g38730-like isoform X6 [Glycine max] Length = 587 Score = 87.4 bits (215), Expect = 2e-15 Identities = 39/65 (60%), Positives = 49/65 (75%) Frame = -2 Query: 196 KWAESIPHYKHSLQPSWTMVHVLVGQKQFKAAQNLLERIAFKDFLSSPSVLNALICSHND 17 KW +SIPHY HSLQ SW M+H+L K FK AQ++LE+IA KDFLSSPSVL L+ +H++ Sbjct: 62 KWLDSIPHYSHSLQCSWAMIHILTEHKHFKTAQHMLEKIAHKDFLSSPSVLTTLVRTHDN 121 Query: 16 PVSNS 2 NS Sbjct: 122 QEVNS 126 >ref|XP_003545840.1| PREDICTED: pentatricopeptide repeat-containing protein At5g38730-like [Glycine max] Length = 587 Score = 87.4 bits (215), Expect = 2e-15 Identities = 39/65 (60%), Positives = 50/65 (76%) Frame = -2 Query: 196 KWAESIPHYKHSLQPSWTMVHVLVGQKQFKAAQNLLERIAFKDFLSSPSVLNALICSHND 17 KW +SIPHY HSLQ SW M+H+L K FK AQ++LE+IA KDFLSSPSVL+ L+ +H++ Sbjct: 62 KWLDSIPHYSHSLQCSWAMIHILTEHKHFKTAQHVLEKIAHKDFLSSPSVLSTLVRTHDN 121 Query: 16 PVSNS 2 NS Sbjct: 122 QEVNS 126 >ref|XP_004140465.1| PREDICTED: pentatricopeptide repeat-containing protein At5g38730-like [Cucumis sativus] gi|449518107|ref|XP_004166085.1| PREDICTED: pentatricopeptide repeat-containing protein At5g38730-like [Cucumis sativus] Length = 578 Score = 84.7 bits (208), Expect = 1e-14 Identities = 39/65 (60%), Positives = 48/65 (73%) Frame = -2 Query: 196 KWAESIPHYKHSLQPSWTMVHVLVGQKQFKAAQNLLERIAFKDFLSSPSVLNALICSHND 17 KW E IP YKHSLQ SW M+ +L K FK AQ LLE+IA KDF+SSP VLNAL+ S+++ Sbjct: 56 KWVELIPDYKHSLQSSWAMIFILTEHKHFKTAQGLLEKIAHKDFISSPLVLNALVTSYDN 115 Query: 16 PVSNS 2 P N+ Sbjct: 116 PDVNA 120 >ref|XP_002532893.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223527353|gb|EEF29498.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 625 Score = 84.7 bits (208), Expect = 1e-14 Identities = 41/66 (62%), Positives = 52/66 (78%), Gaps = 1/66 (1%) Frame = -2 Query: 196 KWAES-IPHYKHSLQPSWTMVHVLVGQKQFKAAQNLLERIAFKDFLSSPSVLNALICSHN 20 KW ES IP+YKHSLQ SWTM+H+L K K AQ+LLE+IA++DFLS+ SVL+AL+ H+ Sbjct: 65 KWIESSIPNYKHSLQSSWTMIHILTKFKHLKTAQSLLEKIAYRDFLSTQSVLSALVRLHD 124 Query: 19 DPVSNS 2 DP NS Sbjct: 125 DPDINS 130 >ref|XP_006340477.1| PREDICTED: pentatricopeptide repeat-containing protein At5g38730-like [Solanum tuberosum] Length = 588 Score = 84.3 bits (207), Expect = 2e-14 Identities = 37/65 (56%), Positives = 53/65 (81%) Frame = -2 Query: 196 KWAESIPHYKHSLQPSWTMVHVLVGQKQFKAAQNLLERIAFKDFLSSPSVLNALICSHND 17 +WAES+P+YKHSLQ SWTM+++L QK FK AQ++L+++A K+FLSSP+VLNA + S+ + Sbjct: 63 QWAESVPNYKHSLQSSWTMIYILTKQKHFKTAQDMLQKVAVKNFLSSPTVLNAFVRSNMN 122 Query: 16 PVSNS 2 NS Sbjct: 123 NDVNS 127 >ref|XP_004237507.1| PREDICTED: pentatricopeptide repeat-containing protein At5g38730-like [Solanum lycopersicum] Length = 588 Score = 82.4 bits (202), Expect = 6e-14 Identities = 37/65 (56%), Positives = 53/65 (81%) Frame = -2 Query: 196 KWAESIPHYKHSLQPSWTMVHVLVGQKQFKAAQNLLERIAFKDFLSSPSVLNALICSHND 17 +WAES+P +KHSLQ SWTM+++L QK FK AQ++L+++A K+FLSSP+VLNAL+ S+ + Sbjct: 63 QWAESVPSHKHSLQSSWTMMYILTKQKHFKTAQDMLQKVAVKNFLSSPTVLNALVRSNMN 122 Query: 16 PVSNS 2 NS Sbjct: 123 NDVNS 127 >ref|XP_003627859.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355521881|gb|AET02335.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 731 Score = 81.6 bits (200), Expect = 1e-13 Identities = 35/65 (53%), Positives = 49/65 (75%) Frame = -2 Query: 196 KWAESIPHYKHSLQPSWTMVHVLVGQKQFKAAQNLLERIAFKDFLSSPSVLNALICSHND 17 KWA+SIPHY HSL SW+M+H+L + FK AQ +L+++A ++ LSSPSVL +L+ H+D Sbjct: 66 KWAQSIPHYTHSLHSSWSMIHMLTKHRHFKTAQQVLDKMAQREILSSPSVLTSLVRIHDD 125 Query: 16 PVSNS 2 P NS Sbjct: 126 PEVNS 130 >ref|XP_004511038.1| PREDICTED: pentatricopeptide repeat-containing protein At5g38730-like [Cicer arietinum] Length = 588 Score = 80.9 bits (198), Expect = 2e-13 Identities = 36/65 (55%), Positives = 47/65 (72%) Frame = -2 Query: 196 KWAESIPHYKHSLQPSWTMVHVLVGQKQFKAAQNLLERIAFKDFLSSPSVLNALICSHND 17 KW SIPHY HSLQ SW+M+H+L FK AQ +L+++A K+ LSSPSVL +L+ H+D Sbjct: 63 KWVHSIPHYTHSLQCSWSMIHMLTKHSHFKTAQQVLDKMAQKEMLSSPSVLTSLVRIHDD 122 Query: 16 PVSNS 2 P NS Sbjct: 123 PEVNS 127 >ref|XP_006373499.1| hypothetical protein POPTR_0017s14300g [Populus trichocarpa] gi|550320321|gb|ERP51296.1| hypothetical protein POPTR_0017s14300g [Populus trichocarpa] Length = 593 Score = 80.5 bits (197), Expect = 2e-13 Identities = 39/66 (59%), Positives = 49/66 (74%), Gaps = 1/66 (1%) Frame = -2 Query: 196 KWAES-IPHYKHSLQPSWTMVHVLVGQKQFKAAQNLLERIAFKDFLSSPSVLNALICSHN 20 KW ES +P+YKHSLQ SWTM+++L K FK A LE IAFKDFLS+ SVL++L+ H+ Sbjct: 71 KWIESSVPNYKHSLQSSWTMLYILTKHKHFKTAHAFLENIAFKDFLSTQSVLSSLVKIHD 130 Query: 19 DPVSNS 2 DP NS Sbjct: 131 DPDVNS 136 >ref|XP_007033427.1| Tetratricopeptide repeat (TPR)-like superfamily protein [Theobroma cacao] gi|508712456|gb|EOY04353.1| Tetratricopeptide repeat (TPR)-like superfamily protein [Theobroma cacao] Length = 593 Score = 79.0 bits (193), Expect = 7e-13 Identities = 40/66 (60%), Positives = 48/66 (72%), Gaps = 1/66 (1%) Frame = -2 Query: 196 KWAE-SIPHYKHSLQPSWTMVHVLVGQKQFKAAQNLLERIAFKDFLSSPSVLNALICSHN 20 KW E SIP+Y HSLQ +W MVH+L K FK A NLL +I+ KDFLSS SVLNAL+ +H+ Sbjct: 65 KWIEISIPNYDHSLQSTWAMVHILTKHKHFKTAHNLLGKISNKDFLSSNSVLNALVSTHS 124 Query: 19 DPVSNS 2 D NS Sbjct: 125 DFEVNS 130