BLASTX nr result
ID: Cocculus22_contig00008704
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus22_contig00008704 (333 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007029254.1| Biotin carboxyl carrier protein subunit of o... 94 2e-17 ref|XP_007029252.1| Biotin carboxyl carrier protein subunit of o... 94 2e-17 gb|ADN52613.1| acetyl-CoA carboxylase BCCP subunit [Jatropha cur... 92 8e-17 gb|ABU41516.1| biotin carboxyl carrier protein subunit [Gossypiu... 90 4e-16 ref|XP_007032701.1| Biotin carboxyl carrier protein of acetyl-Co... 89 8e-16 gb|ACO53610.1| biotin carboxyl carrier protein 1-2 [Arachis hypo... 89 8e-16 gb|ACO53609.1| biotin carboxyl carrier protein 1-1 [Arachis hypo... 89 8e-16 ref|XP_006482734.1| PREDICTED: biotin carboxyl carrier protein o... 88 1e-15 ref|XP_006482733.1| PREDICTED: biotin carboxyl carrier protein o... 88 1e-15 ref|XP_006431277.1| hypothetical protein CICLE_v10012388mg [Citr... 88 1e-15 ref|XP_004489456.1| PREDICTED: biotin carboxyl carrier protein o... 88 1e-15 ref|XP_004489455.1| PREDICTED: biotin carboxyl carrier protein o... 88 1e-15 gb|AFS89700.1| biotin carboxyl carrier protein [Vernicia fordii] 88 1e-15 ref|XP_004489502.1| PREDICTED: biotin carboxyl carrier protein o... 88 1e-15 gb|AFP99173.1| biotin carboxyl carrier protein [Vernicia fordii] 88 1e-15 gb|ACT33948.1| biotin carboxyl carrier protein subunit [Jatropha... 88 1e-15 gb|ABK26424.1| unknown [Picea sitchensis] 88 1e-15 ref|XP_004491870.1| PREDICTED: biotin carboxyl carrier protein o... 87 2e-15 emb|CBI22298.3| unnamed protein product [Vitis vinifera] 87 2e-15 gb|ACN85391.1| acetyl-coenzyme A carboxylase [Suaeda salsa] 87 2e-15 >ref|XP_007029254.1| Biotin carboxyl carrier protein subunit of of Het-ACCase (BCCP1), putative isoform 3 [Theobroma cacao] gi|508717859|gb|EOY09756.1| Biotin carboxyl carrier protein subunit of of Het-ACCase (BCCP1), putative isoform 3 [Theobroma cacao] Length = 310 Score = 94.4 bits (233), Expect = 2e-17 Identities = 46/51 (90%), Positives = 49/51 (96%) Frame = +2 Query: 2 DKVQKGQVVCIIEAMKLMNEIEADQSGKIVEILVEDGKSVSLDMPLLIIEP 154 DKVQKGQV+CIIEAMKLMNEIEADQSG IVEILVEDGKSVS+DMPL +IEP Sbjct: 260 DKVQKGQVICIIEAMKLMNEIEADQSGTIVEILVEDGKSVSVDMPLFVIEP 310 >ref|XP_007029252.1| Biotin carboxyl carrier protein subunit of of Het-ACCase (BCCP1), putative isoform 1 [Theobroma cacao] gi|508717857|gb|EOY09754.1| Biotin carboxyl carrier protein subunit of of Het-ACCase (BCCP1), putative isoform 1 [Theobroma cacao] Length = 279 Score = 94.4 bits (233), Expect = 2e-17 Identities = 46/51 (90%), Positives = 49/51 (96%) Frame = +2 Query: 2 DKVQKGQVVCIIEAMKLMNEIEADQSGKIVEILVEDGKSVSLDMPLLIIEP 154 DKVQKGQV+CIIEAMKLMNEIEADQSG IVEILVEDGKSVS+DMPL +IEP Sbjct: 229 DKVQKGQVICIIEAMKLMNEIEADQSGTIVEILVEDGKSVSVDMPLFVIEP 279 >gb|ADN52613.1| acetyl-CoA carboxylase BCCP subunit [Jatropha curcas] Length = 285 Score = 92.0 bits (227), Expect = 8e-17 Identities = 45/51 (88%), Positives = 48/51 (94%) Frame = +2 Query: 2 DKVQKGQVVCIIEAMKLMNEIEADQSGKIVEILVEDGKSVSLDMPLLIIEP 154 DKVQKGQV+CIIEAMKLMNEIEADQSG IVEIL EDGKSVS+DMPL +IEP Sbjct: 235 DKVQKGQVLCIIEAMKLMNEIEADQSGTIVEILAEDGKSVSVDMPLFVIEP 285 >gb|ABU41516.1| biotin carboxyl carrier protein subunit [Gossypium hirsutum] Length = 282 Score = 89.7 bits (221), Expect = 4e-16 Identities = 43/51 (84%), Positives = 48/51 (94%) Frame = +2 Query: 2 DKVQKGQVVCIIEAMKLMNEIEADQSGKIVEILVEDGKSVSLDMPLLIIEP 154 DKVQKGQV+CIIEAMKLMNEIEADQSG +VEIL EDGK+VS+DMPL +IEP Sbjct: 232 DKVQKGQVLCIIEAMKLMNEIEADQSGTMVEILAEDGKAVSVDMPLFVIEP 282 >ref|XP_007032701.1| Biotin carboxyl carrier protein of acetyl-CoA carboxylase 2, putative [Theobroma cacao] gi|508711730|gb|EOY03627.1| Biotin carboxyl carrier protein of acetyl-CoA carboxylase 2, putative [Theobroma cacao] Length = 288 Score = 88.6 bits (218), Expect = 8e-16 Identities = 44/51 (86%), Positives = 47/51 (92%) Frame = +2 Query: 2 DKVQKGQVVCIIEAMKLMNEIEADQSGKIVEILVEDGKSVSLDMPLLIIEP 154 DKVQKGQVVCIIEAMKLMNEIEADQSG I EIL EDGK+VS+DMPLL+I P Sbjct: 238 DKVQKGQVVCIIEAMKLMNEIEADQSGTISEILAEDGKAVSVDMPLLVIVP 288 >gb|ACO53610.1| biotin carboxyl carrier protein 1-2 [Arachis hypogaea] Length = 279 Score = 88.6 bits (218), Expect = 8e-16 Identities = 43/51 (84%), Positives = 47/51 (92%) Frame = +2 Query: 2 DKVQKGQVVCIIEAMKLMNEIEADQSGKIVEILVEDGKSVSLDMPLLIIEP 154 DKV+KGQV+CIIEAMKLMNEIEADQSG IVEIL EDGK VS+DMPL +IEP Sbjct: 229 DKVKKGQVLCIIEAMKLMNEIEADQSGTIVEILAEDGKPVSVDMPLFVIEP 279 >gb|ACO53609.1| biotin carboxyl carrier protein 1-1 [Arachis hypogaea] Length = 279 Score = 88.6 bits (218), Expect = 8e-16 Identities = 43/51 (84%), Positives = 47/51 (92%) Frame = +2 Query: 2 DKVQKGQVVCIIEAMKLMNEIEADQSGKIVEILVEDGKSVSLDMPLLIIEP 154 DKV+KGQV+CIIEAMKLMNEIEADQSG IVEIL EDGK VS+DMPL +IEP Sbjct: 229 DKVKKGQVLCIIEAMKLMNEIEADQSGTIVEILAEDGKPVSVDMPLFVIEP 279 >ref|XP_006482734.1| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase 2, chloroplastic-like isoform X2 [Citrus sinensis] Length = 283 Score = 88.2 bits (217), Expect = 1e-15 Identities = 44/51 (86%), Positives = 46/51 (90%) Frame = +2 Query: 2 DKVQKGQVVCIIEAMKLMNEIEADQSGKIVEILVEDGKSVSLDMPLLIIEP 154 DKVQKGQVVCIIEAMKLMNEIEADQSG I EIL EDGKSVS+D PLL+I P Sbjct: 233 DKVQKGQVVCIIEAMKLMNEIEADQSGTIAEILAEDGKSVSVDTPLLVIVP 283 >ref|XP_006482733.1| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase 2, chloroplastic-like isoform X1 [Citrus sinensis] Length = 286 Score = 88.2 bits (217), Expect = 1e-15 Identities = 44/51 (86%), Positives = 46/51 (90%) Frame = +2 Query: 2 DKVQKGQVVCIIEAMKLMNEIEADQSGKIVEILVEDGKSVSLDMPLLIIEP 154 DKVQKGQVVCIIEAMKLMNEIEADQSG I EIL EDGKSVS+D PLL+I P Sbjct: 236 DKVQKGQVVCIIEAMKLMNEIEADQSGTIAEILAEDGKSVSVDTPLLVIVP 286 >ref|XP_006431277.1| hypothetical protein CICLE_v10012388mg [Citrus clementina] gi|557533334|gb|ESR44517.1| hypothetical protein CICLE_v10012388mg [Citrus clementina] Length = 286 Score = 88.2 bits (217), Expect = 1e-15 Identities = 44/51 (86%), Positives = 46/51 (90%) Frame = +2 Query: 2 DKVQKGQVVCIIEAMKLMNEIEADQSGKIVEILVEDGKSVSLDMPLLIIEP 154 DKVQKGQVVCIIEAMKLMNEIEADQSG I EIL EDGKSVS+D PLL+I P Sbjct: 236 DKVQKGQVVCIIEAMKLMNEIEADQSGTIAEILAEDGKSVSVDTPLLVIVP 286 >ref|XP_004489456.1| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase 1, chloroplastic-like isoform X2 [Cicer arietinum] Length = 282 Score = 88.2 bits (217), Expect = 1e-15 Identities = 43/51 (84%), Positives = 46/51 (90%) Frame = +2 Query: 2 DKVQKGQVVCIIEAMKLMNEIEADQSGKIVEILVEDGKSVSLDMPLLIIEP 154 DKVQKGQVVCIIEAMKLMNEIEADQSG I EILVEDGK VS+D+PL +I P Sbjct: 232 DKVQKGQVVCIIEAMKLMNEIEADQSGTITEILVEDGKPVSIDLPLFVIAP 282 >ref|XP_004489455.1| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase 1, chloroplastic-like isoform X1 [Cicer arietinum] Length = 311 Score = 88.2 bits (217), Expect = 1e-15 Identities = 43/51 (84%), Positives = 46/51 (90%) Frame = +2 Query: 2 DKVQKGQVVCIIEAMKLMNEIEADQSGKIVEILVEDGKSVSLDMPLLIIEP 154 DKVQKGQVVCIIEAMKLMNEIEADQSG I EILVEDGK VS+D+PL +I P Sbjct: 261 DKVQKGQVVCIIEAMKLMNEIEADQSGTITEILVEDGKPVSIDLPLFVIAP 311 >gb|AFS89700.1| biotin carboxyl carrier protein [Vernicia fordii] Length = 252 Score = 87.8 bits (216), Expect = 1e-15 Identities = 43/51 (84%), Positives = 46/51 (90%) Frame = +2 Query: 2 DKVQKGQVVCIIEAMKLMNEIEADQSGKIVEILVEDGKSVSLDMPLLIIEP 154 DKVQKGQVVCIIEAMKLMNEIEADQSG I EILVEDGK VS+D+PL +I P Sbjct: 202 DKVQKGQVVCIIEAMKLMNEIEADQSGTIAEILVEDGKPVSVDLPLFVIAP 252 >ref|XP_004489502.1| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase, chloroplastic-like [Cicer arietinum] Length = 285 Score = 87.8 bits (216), Expect = 1e-15 Identities = 44/51 (86%), Positives = 45/51 (88%) Frame = +2 Query: 2 DKVQKGQVVCIIEAMKLMNEIEADQSGKIVEILVEDGKSVSLDMPLLIIEP 154 DKVQKGQVVCIIEAMKLMNEIEADQSG I EILVEDGK VS+DMPL I P Sbjct: 235 DKVQKGQVVCIIEAMKLMNEIEADQSGTITEILVEDGKPVSIDMPLFAIAP 285 >gb|AFP99173.1| biotin carboxyl carrier protein [Vernicia fordii] Length = 270 Score = 87.8 bits (216), Expect = 1e-15 Identities = 43/51 (84%), Positives = 46/51 (90%) Frame = +2 Query: 2 DKVQKGQVVCIIEAMKLMNEIEADQSGKIVEILVEDGKSVSLDMPLLIIEP 154 DKVQKGQVVCIIEAMKLMNEIEADQSG I EILVEDGK VS+D+PL +I P Sbjct: 220 DKVQKGQVVCIIEAMKLMNEIEADQSGTIAEILVEDGKPVSVDLPLFVIAP 270 >gb|ACT33948.1| biotin carboxyl carrier protein subunit [Jatropha curcas] Length = 270 Score = 87.8 bits (216), Expect = 1e-15 Identities = 43/51 (84%), Positives = 46/51 (90%) Frame = +2 Query: 2 DKVQKGQVVCIIEAMKLMNEIEADQSGKIVEILVEDGKSVSLDMPLLIIEP 154 DKVQKGQVVCIIEAMKLMNEIEADQ+G I EILVEDGK VS+DMPL +I P Sbjct: 220 DKVQKGQVVCIIEAMKLMNEIEADQAGTIAEILVEDGKPVSVDMPLFVIAP 270 >gb|ABK26424.1| unknown [Picea sitchensis] Length = 309 Score = 87.8 bits (216), Expect = 1e-15 Identities = 41/51 (80%), Positives = 48/51 (94%) Frame = +2 Query: 2 DKVQKGQVVCIIEAMKLMNEIEADQSGKIVEILVEDGKSVSLDMPLLIIEP 154 DKVQKGQV+CI+EAMKLMNEIEAD+SG IVEILVEDGK V++DMPL +I+P Sbjct: 259 DKVQKGQVICIVEAMKLMNEIEADRSGTIVEILVEDGKPVAVDMPLFVIKP 309 >ref|XP_004491870.1| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase 1, chloroplastic-like [Cicer arietinum] Length = 276 Score = 87.4 bits (215), Expect = 2e-15 Identities = 43/51 (84%), Positives = 45/51 (88%) Frame = +2 Query: 2 DKVQKGQVVCIIEAMKLMNEIEADQSGKIVEILVEDGKSVSLDMPLLIIEP 154 DKVQKGQVVCIIEAMKLMNEIEADQSG + EILVEDGK VS+DMPL I P Sbjct: 226 DKVQKGQVVCIIEAMKLMNEIEADQSGTVTEILVEDGKPVSIDMPLFAIAP 276 >emb|CBI22298.3| unnamed protein product [Vitis vinifera] Length = 71 Score = 87.0 bits (214), Expect = 2e-15 Identities = 43/51 (84%), Positives = 45/51 (88%) Frame = +2 Query: 2 DKVQKGQVVCIIEAMKLMNEIEADQSGKIVEILVEDGKSVSLDMPLLIIEP 154 DKVQKGQVVCIIEAMKLMNEIEADQSG I EIL EDGK VS+D PLL+I P Sbjct: 21 DKVQKGQVVCIIEAMKLMNEIEADQSGTITEILAEDGKPVSIDRPLLVIAP 71 >gb|ACN85391.1| acetyl-coenzyme A carboxylase [Suaeda salsa] Length = 257 Score = 87.0 bits (214), Expect = 2e-15 Identities = 42/51 (82%), Positives = 47/51 (92%) Frame = +2 Query: 2 DKVQKGQVVCIIEAMKLMNEIEADQSGKIVEILVEDGKSVSLDMPLLIIEP 154 DKV+KGQV+CIIEAMKLMNEIEADQSG IVEIL +DGK VS+DMPL +IEP Sbjct: 207 DKVKKGQVLCIIEAMKLMNEIEADQSGTIVEILAKDGKPVSVDMPLFVIEP 257