BLASTX nr result
ID: Cocculus22_contig00008545
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus22_contig00008545 (307 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002523200.1| conserved hypothetical protein [Ricinus comm... 57 2e-06 >ref|XP_002523200.1| conserved hypothetical protein [Ricinus communis] gi|223537607|gb|EEF39231.1| conserved hypothetical protein [Ricinus communis] Length = 783 Score = 57.4 bits (137), Expect = 2e-06 Identities = 32/82 (39%), Positives = 45/82 (54%) Frame = +2 Query: 56 TASSSQEPEPSANSDDTGTATVENGVVAIELKEDTRSSTGEDNKPAEWVQWRETLDSSEP 235 TA+SS PEPS + D +G L ED++ G + KP WV+WRET D+++P Sbjct: 633 TATSSPAPEPSLD-DSSGN----------NLSEDSKEIVGNE-KPTVWVEWRETPDTNDP 680 Query: 236 DREETPALPNGQLQDVKEQSDG 301 + P +PNG+LQ E G Sbjct: 681 FNPDVPPVPNGELQVDSENQGG 702