BLASTX nr result
ID: Cocculus22_contig00008278
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus22_contig00008278 (272 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002434127.1| secreted protein [Ixodes scapularis] gi|6708... 57 2e-06 >ref|XP_002434127.1| secreted protein [Ixodes scapularis] gi|67083357|gb|AAY66614.1| putative secreted protein [Ixodes scapularis] gi|215495886|gb|EEC05527.1| secreted protein [Ixodes scapularis] Length = 65 Score = 57.4 bits (137), Expect = 2e-06 Identities = 31/54 (57%), Positives = 33/54 (61%) Frame = -3 Query: 246 PN*GETAEGSLYQLWFNRSYSVTWITAEILELIHANRVPTGDGRDAFIRSKPIG 85 P GETA GSL QLWF RS+ TWIT ILELIHA AFIR + IG Sbjct: 2 PKQGETANGSLNQLWFLRSFLPTWITVAILELIHAVSPKPLGATGAFIRPRSIG 55