BLASTX nr result
ID: Cocculus22_contig00007841
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus22_contig00007841 (675 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006842967.1| hypothetical protein AMTR_s00076p00039590, p... 59 1e-06 >ref|XP_006842967.1| hypothetical protein AMTR_s00076p00039590, partial [Amborella trichopoda] gi|548845164|gb|ERN04642.1| hypothetical protein AMTR_s00076p00039590, partial [Amborella trichopoda] Length = 550 Score = 58.9 bits (141), Expect = 1e-06 Identities = 25/42 (59%), Positives = 31/42 (73%) Frame = +2 Query: 2 LERALNGEWFLFPLENKDGSSLQPIHLSSDESKPCVIGYD*H 127 LERAL+GEWFL P N+ ++PIHLS DE KPC+IG + H Sbjct: 495 LERALSGEWFLLPANNEGKDVMEPIHLSKDEHKPCIIGNNSH 536