BLASTX nr result
ID: Cocculus22_contig00007802
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus22_contig00007802 (418 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006444138.1| hypothetical protein CICLE_v10020406mg [Citr... 79 5e-13 ref|XP_002271534.2| PREDICTED: BTB/POZ and MATH domain-containin... 78 1e-12 emb|CBI32329.3| unnamed protein product [Vitis vinifera] 78 1e-12 ref|XP_007050686.1| BTB-POZ and MATH domain 2 [Theobroma cacao] ... 77 2e-12 ref|XP_002524811.1| Speckle-type POZ protein, putative [Ricinus ... 77 2e-12 gb|EYU46623.1| hypothetical protein MIMGU_mgv1a007354mg [Mimulus... 76 4e-12 ref|XP_006489244.1| PREDICTED: BTB/POZ and MATH domain-containin... 75 1e-11 ref|XP_006419782.1| hypothetical protein CICLE_v10005094mg [Citr... 75 1e-11 ref|XP_004247493.1| PREDICTED: BTB/POZ and MATH domain-containin... 75 1e-11 ref|XP_006588617.1| PREDICTED: BTB/POZ and MATH domain-containin... 74 2e-11 ref|XP_007034571.1| BTB-POZ and MATH domain 2 [Theobroma cacao] ... 74 3e-11 ref|XP_004493645.1| PREDICTED: BTB/POZ and MATH domain-containin... 74 3e-11 ref|XP_004290680.1| PREDICTED: BTB/POZ and MATH domain-containin... 74 3e-11 ref|XP_006407971.1| hypothetical protein EUTSA_v10020850mg [Eutr... 72 6e-11 ref|XP_003631982.1| PREDICTED: BTB/POZ and MATH domain-containin... 72 6e-11 ref|XP_002279548.1| PREDICTED: BTB/POZ and MATH domain-containin... 72 6e-11 ref|XP_002315535.1| speckle-type POZ family protein [Populus tri... 72 6e-11 gb|AFK40364.1| unknown [Medicago truncatula] 72 8e-11 ref|XP_003590694.1| Speckle-type POZ protein [Medicago truncatul... 72 8e-11 ref|XP_003590693.1| Speckle-type POZ protein [Medicago truncatul... 72 8e-11 >ref|XP_006444138.1| hypothetical protein CICLE_v10020406mg [Citrus clementina] gi|568852211|ref|XP_006479773.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like [Citrus sinensis] gi|557546400|gb|ESR57378.1| hypothetical protein CICLE_v10020406mg [Citrus clementina] Length = 407 Score = 79.3 bits (194), Expect = 5e-13 Identities = 35/40 (87%), Positives = 38/40 (95%) Frame = -1 Query: 121 LIDTVNGSHQFKITGYSLSKGLGVGKYIASDIFMVGGYAW 2 + +TVNGSHQFKITGYSLSKGLG+GKYIASD FMVGGYAW Sbjct: 29 ITETVNGSHQFKITGYSLSKGLGIGKYIASDTFMVGGYAW 68 >ref|XP_002271534.2| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like [Vitis vinifera] Length = 489 Score = 77.8 bits (190), Expect = 1e-12 Identities = 34/40 (85%), Positives = 38/40 (95%) Frame = -1 Query: 121 LIDTVNGSHQFKITGYSLSKGLGVGKYIASDIFMVGGYAW 2 + +TVNGSHQFKITGYSLSKGLG+GKYIASD F+VGGYAW Sbjct: 24 ITETVNGSHQFKITGYSLSKGLGIGKYIASDTFVVGGYAW 63 >emb|CBI32329.3| unnamed protein product [Vitis vinifera] Length = 402 Score = 77.8 bits (190), Expect = 1e-12 Identities = 34/40 (85%), Positives = 38/40 (95%) Frame = -1 Query: 121 LIDTVNGSHQFKITGYSLSKGLGVGKYIASDIFMVGGYAW 2 + +TVNGSHQFKITGYSLSKGLG+GKYIASD F+VGGYAW Sbjct: 24 ITETVNGSHQFKITGYSLSKGLGIGKYIASDTFVVGGYAW 63 >ref|XP_007050686.1| BTB-POZ and MATH domain 2 [Theobroma cacao] gi|508702947|gb|EOX94843.1| BTB-POZ and MATH domain 2 [Theobroma cacao] Length = 493 Score = 77.0 bits (188), Expect = 2e-12 Identities = 34/38 (89%), Positives = 36/38 (94%) Frame = -1 Query: 115 DTVNGSHQFKITGYSLSKGLGVGKYIASDIFMVGGYAW 2 +TVNGSHQFKITGYSLSKGLG+GKYIASD FMVGGY W Sbjct: 30 ETVNGSHQFKITGYSLSKGLGIGKYIASDTFMVGGYLW 67 >ref|XP_002524811.1| Speckle-type POZ protein, putative [Ricinus communis] gi|223535995|gb|EEF37654.1| Speckle-type POZ protein, putative [Ricinus communis] Length = 500 Score = 77.0 bits (188), Expect = 2e-12 Identities = 34/40 (85%), Positives = 37/40 (92%) Frame = -1 Query: 121 LIDTVNGSHQFKITGYSLSKGLGVGKYIASDIFMVGGYAW 2 + DTVNGSHQFKITGYSLSKGLG+GKYIASD F VGGY+W Sbjct: 35 ITDTVNGSHQFKITGYSLSKGLGIGKYIASDTFNVGGYSW 74 >gb|EYU46623.1| hypothetical protein MIMGU_mgv1a007354mg [Mimulus guttatus] Length = 410 Score = 76.3 bits (186), Expect = 4e-12 Identities = 33/38 (86%), Positives = 36/38 (94%) Frame = -1 Query: 115 DTVNGSHQFKITGYSLSKGLGVGKYIASDIFMVGGYAW 2 +TVNGSH FKITGYSLSKG+G+GKYIASD FMVGGYAW Sbjct: 34 ETVNGSHDFKITGYSLSKGIGIGKYIASDTFMVGGYAW 71 >ref|XP_006489244.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like [Citrus sinensis] Length = 403 Score = 74.7 bits (182), Expect = 1e-11 Identities = 31/38 (81%), Positives = 37/38 (97%) Frame = -1 Query: 115 DTVNGSHQFKITGYSLSKGLGVGKYIASDIFMVGGYAW 2 +T+NGSHQFKI+GYSLSKG+G+GKYIASD F+VGGYAW Sbjct: 26 ETINGSHQFKISGYSLSKGMGIGKYIASDTFIVGGYAW 63 >ref|XP_006419782.1| hypothetical protein CICLE_v10005094mg [Citrus clementina] gi|557521655|gb|ESR33022.1| hypothetical protein CICLE_v10005094mg [Citrus clementina] Length = 403 Score = 74.7 bits (182), Expect = 1e-11 Identities = 31/38 (81%), Positives = 37/38 (97%) Frame = -1 Query: 115 DTVNGSHQFKITGYSLSKGLGVGKYIASDIFMVGGYAW 2 +T+NGSHQFKI+GYSLSKG+G+GKYIASD F+VGGYAW Sbjct: 26 ETINGSHQFKISGYSLSKGMGIGKYIASDTFIVGGYAW 63 >ref|XP_004247493.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like [Solanum lycopersicum] Length = 499 Score = 74.7 bits (182), Expect = 1e-11 Identities = 32/38 (84%), Positives = 35/38 (92%) Frame = -1 Query: 115 DTVNGSHQFKITGYSLSKGLGVGKYIASDIFMVGGYAW 2 +TVNGSH FKITGYSLSKG+G+GKYIASD FMVGGY W Sbjct: 36 ETVNGSHDFKITGYSLSKGIGIGKYIASDTFMVGGYTW 73 >ref|XP_006588617.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like [Glycine max] Length = 413 Score = 74.3 bits (181), Expect = 2e-11 Identities = 33/40 (82%), Positives = 36/40 (90%) Frame = -1 Query: 121 LIDTVNGSHQFKITGYSLSKGLGVGKYIASDIFMVGGYAW 2 L DTV GSH+FKITGYSLSKG+G+GKYIASDIF VGGY W Sbjct: 35 LTDTVRGSHRFKITGYSLSKGIGIGKYIASDIFSVGGYDW 74 >ref|XP_007034571.1| BTB-POZ and MATH domain 2 [Theobroma cacao] gi|508713600|gb|EOY05497.1| BTB-POZ and MATH domain 2 [Theobroma cacao] Length = 410 Score = 73.6 bits (179), Expect = 3e-11 Identities = 32/40 (80%), Positives = 37/40 (92%) Frame = -1 Query: 121 LIDTVNGSHQFKITGYSLSKGLGVGKYIASDIFMVGGYAW 2 L +TVNGSHQFKI+GYSL+KG+GVGKYIAS+ FMVGGY W Sbjct: 31 LTETVNGSHQFKISGYSLAKGMGVGKYIASETFMVGGYEW 70 >ref|XP_004493645.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like [Cicer arietinum] Length = 497 Score = 73.6 bits (179), Expect = 3e-11 Identities = 32/40 (80%), Positives = 36/40 (90%) Frame = -1 Query: 121 LIDTVNGSHQFKITGYSLSKGLGVGKYIASDIFMVGGYAW 2 + +TV GSHQFKITGYSLSKG+G+GKYIASDIF VGGY W Sbjct: 32 ITETVRGSHQFKITGYSLSKGIGIGKYIASDIFSVGGYDW 71 >ref|XP_004290680.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like [Fragaria vesca subsp. vesca] Length = 411 Score = 73.6 bits (179), Expect = 3e-11 Identities = 29/40 (72%), Positives = 38/40 (95%) Frame = -1 Query: 121 LIDTVNGSHQFKITGYSLSKGLGVGKYIASDIFMVGGYAW 2 + +TVNG+HQFKITGYSLSKG+G+GKY++SD+F VGGY+W Sbjct: 33 ITETVNGTHQFKITGYSLSKGMGIGKYVSSDVFNVGGYSW 72 >ref|XP_006407971.1| hypothetical protein EUTSA_v10020850mg [Eutrema salsugineum] gi|557109117|gb|ESQ49424.1| hypothetical protein EUTSA_v10020850mg [Eutrema salsugineum] Length = 406 Score = 72.4 bits (176), Expect = 6e-11 Identities = 28/38 (73%), Positives = 37/38 (97%) Frame = -1 Query: 115 DTVNGSHQFKITGYSLSKGLGVGKYIASDIFMVGGYAW 2 +T+NGSH+FKI+GYSL+KG+G+GKY+ASD FMVGGY+W Sbjct: 29 ETINGSHEFKISGYSLAKGMGIGKYVASDTFMVGGYSW 66 >ref|XP_003631982.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2 isoform 2 [Vitis vinifera] Length = 443 Score = 72.4 bits (176), Expect = 6e-11 Identities = 30/38 (78%), Positives = 36/38 (94%) Frame = -1 Query: 115 DTVNGSHQFKITGYSLSKGLGVGKYIASDIFMVGGYAW 2 +TVNGSH+FKI GYSL+KG+G+G+YIASD FMVGGYAW Sbjct: 30 ETVNGSHEFKIDGYSLAKGMGIGRYIASDTFMVGGYAW 67 >ref|XP_002279548.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2 isoform 1 [Vitis vinifera] gi|297736968|emb|CBI26169.3| unnamed protein product [Vitis vinifera] Length = 408 Score = 72.4 bits (176), Expect = 6e-11 Identities = 30/38 (78%), Positives = 36/38 (94%) Frame = -1 Query: 115 DTVNGSHQFKITGYSLSKGLGVGKYIASDIFMVGGYAW 2 +TVNGSH+FKI GYSL+KG+G+G+YIASD FMVGGYAW Sbjct: 30 ETVNGSHEFKIDGYSLAKGMGIGRYIASDTFMVGGYAW 67 >ref|XP_002315535.1| speckle-type POZ family protein [Populus trichocarpa] gi|222864575|gb|EEF01706.1| speckle-type POZ family protein [Populus trichocarpa] Length = 410 Score = 72.4 bits (176), Expect = 6e-11 Identities = 31/40 (77%), Positives = 36/40 (90%) Frame = -1 Query: 121 LIDTVNGSHQFKITGYSLSKGLGVGKYIASDIFMVGGYAW 2 + +TVNGSH+FKI GYSLSKG+GVGKYIASD F +GGYAW Sbjct: 33 ITETVNGSHEFKIGGYSLSKGMGVGKYIASDTFYIGGYAW 72 >gb|AFK40364.1| unknown [Medicago truncatula] Length = 418 Score = 72.0 bits (175), Expect = 8e-11 Identities = 30/40 (75%), Positives = 36/40 (90%) Frame = -1 Query: 121 LIDTVNGSHQFKITGYSLSKGLGVGKYIASDIFMVGGYAW 2 + DT+ GSH+FKITGYSLSKG+G+GKYIAS+IF VGGY W Sbjct: 36 ITDTIKGSHRFKITGYSLSKGIGIGKYIASEIFTVGGYEW 75 >ref|XP_003590694.1| Speckle-type POZ protein [Medicago truncatula] gi|355479742|gb|AES60945.1| Speckle-type POZ protein [Medicago truncatula] Length = 264 Score = 72.0 bits (175), Expect = 8e-11 Identities = 30/40 (75%), Positives = 36/40 (90%) Frame = -1 Query: 121 LIDTVNGSHQFKITGYSLSKGLGVGKYIASDIFMVGGYAW 2 + DT+ GSH+FKITGYSLSKG+G+GKYIAS+IF VGGY W Sbjct: 36 ITDTIKGSHRFKITGYSLSKGIGIGKYIASEIFTVGGYEW 75 >ref|XP_003590693.1| Speckle-type POZ protein [Medicago truncatula] gi|355479741|gb|AES60944.1| Speckle-type POZ protein [Medicago truncatula] Length = 418 Score = 72.0 bits (175), Expect = 8e-11 Identities = 30/40 (75%), Positives = 36/40 (90%) Frame = -1 Query: 121 LIDTVNGSHQFKITGYSLSKGLGVGKYIASDIFMVGGYAW 2 + DT+ GSH+FKITGYSLSKG+G+GKYIAS+IF VGGY W Sbjct: 36 ITDTIKGSHRFKITGYSLSKGIGIGKYIASEIFTVGGYEW 75