BLASTX nr result
ID: Cocculus22_contig00007293
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus22_contig00007293 (350 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007205788.1| hypothetical protein PRUPE_ppa010549mg [Prun... 67 3e-09 gb|AAF65768.1|AF242310_1 manganese superoxide dismutase [Euphorb... 65 7e-09 gb|AFD50702.1| manganese superoxide dismutase [Suaeda salsa] 65 7e-09 gb|ABH11434.2| Mn-superoxide dismutase II [Helianthus annuus] 65 7e-09 sp|P35017.1|SODM_HEVBR RecName: Full=Superoxide dismutase [Mn], ... 65 1e-08 gb|ABH11433.2| Mn-superoxide dismutase I [Helianthus annuus] 65 1e-08 emb|CAC13961.1| IgE-binding protein MnSOD [Hevea brasiliensis] 65 1e-08 emb|CAB53458.1| MnSOD [Hevea brasiliensis] 65 1e-08 gb|AFJ42576.1| anganese superoxide dismutase [Sesamum indicum] 65 1e-08 gb|ACO72899.1| superoxide dismutase [Knorringia sibirica] 65 1e-08 ref|XP_002520856.1| superoxide dismutase [mn], putative [Ricinus... 65 1e-08 gb|ABR29644.1| manganese superoxide dismutase-like protein [Pist... 65 1e-08 emb|CAC05259.1| manganese superoxide dismutase [Digitalis lanata] 65 1e-08 gb|AFD50703.1| manganese superoxide dismutase [Salicornia europaea] 64 2e-08 gb|AFF57843.1| Mn/Fe superoxide dismutase [Tetradium ruticarpum] 64 2e-08 gb|AFD34190.1| Mn superoxide dismutase [Jatropha curcas] 64 2e-08 ref|XP_004240868.1| PREDICTED: superoxide dismutase [Mn], mitoch... 64 3e-08 ref|XP_007011340.1| Superoxide dismutase [Theobroma cacao] gi|50... 63 4e-08 gb|ABI35908.1| manganese superoxide dismutase [Rheum australe] 63 4e-08 sp|P11796.1|SODM_NICPL RecName: Full=Superoxide dismutase [Mn], ... 63 5e-08 >ref|XP_007205788.1| hypothetical protein PRUPE_ppa010549mg [Prunus persica] gi|462401430|gb|EMJ06987.1| hypothetical protein PRUPE_ppa010549mg [Prunus persica] Length = 245 Score = 66.6 bits (161), Expect = 3e-09 Identities = 27/29 (93%), Positives = 29/29 (100%) Frame = +3 Query: 3 KNVRPDYLKNIWKVINWKYASDLYKKECP 89 KNVRPDYLKNIWKVINWKYASD+Y+KECP Sbjct: 217 KNVRPDYLKNIWKVINWKYASDVYEKECP 245 >gb|AAF65768.1|AF242310_1 manganese superoxide dismutase [Euphorbia esula] Length = 237 Score = 65.5 bits (158), Expect = 7e-09 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +3 Query: 3 KNVRPDYLKNIWKVINWKYASDLYKKECPS 92 KNVRPDYLKNIWKV+NWKYASD+Y ECPS Sbjct: 207 KNVRPDYLKNIWKVVNWKYASDIYANECPS 236 >gb|AFD50702.1| manganese superoxide dismutase [Suaeda salsa] Length = 232 Score = 65.5 bits (158), Expect = 7e-09 Identities = 26/30 (86%), Positives = 30/30 (100%) Frame = +3 Query: 3 KNVRPDYLKNIWKVINWKYASDLYKKECPS 92 KNVRPDYLKNIWKV+NWKYAS++Y+KECPS Sbjct: 202 KNVRPDYLKNIWKVMNWKYASEVYEKECPS 231 >gb|ABH11434.2| Mn-superoxide dismutase II [Helianthus annuus] Length = 228 Score = 65.5 bits (158), Expect = 7e-09 Identities = 26/29 (89%), Positives = 29/29 (100%) Frame = +3 Query: 3 KNVRPDYLKNIWKVINWKYASDLYKKECP 89 KNVRPDYLKNIWKVINWKYAS++Y+KECP Sbjct: 200 KNVRPDYLKNIWKVINWKYASEIYEKECP 228 >sp|P35017.1|SODM_HEVBR RecName: Full=Superoxide dismutase [Mn], mitochondrial; Flags: Precursor gi|348137|gb|AAA16792.1| superoxide dismutase (manganese) [Hevea brasiliensis] Length = 233 Score = 65.1 bits (157), Expect = 1e-08 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = +3 Query: 3 KNVRPDYLKNIWKVINWKYASDLYKKECPST 95 KNVRPDYLKNIWKV+NWKYAS++Y KECPS+ Sbjct: 203 KNVRPDYLKNIWKVMNWKYASEVYAKECPSS 233 >gb|ABH11433.2| Mn-superoxide dismutase I [Helianthus annuus] Length = 226 Score = 65.1 bits (157), Expect = 1e-08 Identities = 26/29 (89%), Positives = 29/29 (100%) Frame = +3 Query: 3 KNVRPDYLKNIWKVINWKYASDLYKKECP 89 KNVRPDYLKNIWKVINWKYAS++Y+KECP Sbjct: 198 KNVRPDYLKNIWKVINWKYASEVYEKECP 226 >emb|CAC13961.1| IgE-binding protein MnSOD [Hevea brasiliensis] Length = 205 Score = 65.1 bits (157), Expect = 1e-08 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = +3 Query: 3 KNVRPDYLKNIWKVINWKYASDLYKKECPST 95 KNVRPDYLKNIWKV+NWKYAS++Y KECPS+ Sbjct: 175 KNVRPDYLKNIWKVMNWKYASEVYAKECPSS 205 >emb|CAB53458.1| MnSOD [Hevea brasiliensis] Length = 205 Score = 65.1 bits (157), Expect = 1e-08 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = +3 Query: 3 KNVRPDYLKNIWKVINWKYASDLYKKECPST 95 KNVRPDYLKNIWKV+NWKYAS++Y KECPS+ Sbjct: 175 KNVRPDYLKNIWKVMNWKYASEVYAKECPSS 205 >gb|AFJ42576.1| anganese superoxide dismutase [Sesamum indicum] Length = 225 Score = 64.7 bits (156), Expect = 1e-08 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = +3 Query: 3 KNVRPDYLKNIWKVINWKYASDLYKKECP 89 KNVRPDYLKNIWKV+NWKYASD+Y KECP Sbjct: 197 KNVRPDYLKNIWKVMNWKYASDVYDKECP 225 >gb|ACO72899.1| superoxide dismutase [Knorringia sibirica] Length = 234 Score = 64.7 bits (156), Expect = 1e-08 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = +3 Query: 3 KNVRPDYLKNIWKVINWKYASDLYKKECPS 92 KNVRPDYL NIWKVINWKYAS+LY+KECP+ Sbjct: 202 KNVRPDYLNNIWKVINWKYASELYEKECPT 231 >ref|XP_002520856.1| superoxide dismutase [mn], putative [Ricinus communis] gi|223539987|gb|EEF41565.1| superoxide dismutase [mn], putative [Ricinus communis] Length = 234 Score = 64.7 bits (156), Expect = 1e-08 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = +3 Query: 3 KNVRPDYLKNIWKVINWKYASDLYKKECPS 92 KNVRPDYLKNIWKV+NWKYAS++Y KECPS Sbjct: 204 KNVRPDYLKNIWKVMNWKYASEVYAKECPS 233 >gb|ABR29644.1| manganese superoxide dismutase-like protein [Pistacia vera] Length = 230 Score = 64.7 bits (156), Expect = 1e-08 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = +3 Query: 3 KNVRPDYLKNIWKVINWKYASDLYKKECP 89 KNVRPDYLKNIWKVINWKYA +LY+KECP Sbjct: 202 KNVRPDYLKNIWKVINWKYAGELYQKECP 230 >emb|CAC05259.1| manganese superoxide dismutase [Digitalis lanata] Length = 224 Score = 64.7 bits (156), Expect = 1e-08 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = +3 Query: 3 KNVRPDYLKNIWKVINWKYASDLYKKECP 89 KNVRPDYLKNIWKVINWKYAS++Y KECP Sbjct: 196 KNVRPDYLKNIWKVINWKYASEIYDKECP 224 >gb|AFD50703.1| manganese superoxide dismutase [Salicornia europaea] Length = 232 Score = 64.3 bits (155), Expect = 2e-08 Identities = 25/30 (83%), Positives = 30/30 (100%) Frame = +3 Query: 3 KNVRPDYLKNIWKVINWKYASDLYKKECPS 92 KNV+PDYLKNIWKV+NWKYAS++Y+KECPS Sbjct: 202 KNVKPDYLKNIWKVMNWKYASEVYEKECPS 231 >gb|AFF57843.1| Mn/Fe superoxide dismutase [Tetradium ruticarpum] Length = 228 Score = 63.9 bits (154), Expect = 2e-08 Identities = 25/29 (86%), Positives = 29/29 (100%) Frame = +3 Query: 3 KNVRPDYLKNIWKVINWKYASDLYKKECP 89 KNVRPDYLKNIWKV+NWKYAS++Y+KECP Sbjct: 200 KNVRPDYLKNIWKVMNWKYASEVYQKECP 228 >gb|AFD34190.1| Mn superoxide dismutase [Jatropha curcas] Length = 239 Score = 63.9 bits (154), Expect = 2e-08 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +3 Query: 3 KNVRPDYLKNIWKVINWKYASDLYKKECPS 92 KNVRPDYLKNIWKVINWKYAS++Y ECPS Sbjct: 209 KNVRPDYLKNIWKVINWKYASEVYANECPS 238 >ref|XP_004240868.1| PREDICTED: superoxide dismutase [Mn], mitochondrial-like [Solanum lycopersicum] Length = 228 Score = 63.5 bits (153), Expect = 3e-08 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = +3 Query: 3 KNVRPDYLKNIWKVINWKYASDLYKKECP 89 KNVRPDYLKNIWKVINWKYA+D+Y+ ECP Sbjct: 200 KNVRPDYLKNIWKVINWKYANDVYENECP 228 >ref|XP_007011340.1| Superoxide dismutase [Theobroma cacao] gi|508728253|gb|EOY20150.1| Superoxide dismutase [Theobroma cacao] Length = 230 Score = 63.2 bits (152), Expect = 4e-08 Identities = 25/29 (86%), Positives = 29/29 (100%) Frame = +3 Query: 3 KNVRPDYLKNIWKVINWKYASDLYKKECP 89 KNVRPDYLKNIWKVI+WKYAS++Y+KECP Sbjct: 202 KNVRPDYLKNIWKVIDWKYASEVYEKECP 230 >gb|ABI35908.1| manganese superoxide dismutase [Rheum australe] Length = 233 Score = 63.2 bits (152), Expect = 4e-08 Identities = 24/30 (80%), Positives = 29/30 (96%) Frame = +3 Query: 3 KNVRPDYLKNIWKVINWKYASDLYKKECPS 92 KNV+PDYL NIWKV+NWKYAS+LY+KECP+ Sbjct: 201 KNVKPDYLNNIWKVVNWKYASELYEKECPT 230 >sp|P11796.1|SODM_NICPL RecName: Full=Superoxide dismutase [Mn], mitochondrial; Flags: Precursor gi|19693|emb|CAA32643.1| unnamed protein product [Nicotiana plumbaginifolia] Length = 228 Score = 62.8 bits (151), Expect = 5e-08 Identities = 24/29 (82%), Positives = 29/29 (100%) Frame = +3 Query: 3 KNVRPDYLKNIWKVINWKYASDLYKKECP 89 KNVRPDYLKNIWKV+NWKYA+++Y+KECP Sbjct: 200 KNVRPDYLKNIWKVMNWKYANEVYEKECP 228