BLASTX nr result
ID: Cocculus22_contig00006437
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus22_contig00006437 (426 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002269218.1| PREDICTED: putative zinc metalloprotease slr... 62 6e-08 gb|EXB37885.1| Putative zinc metalloprotease [Morus notabilis] 60 4e-07 ref|XP_007215370.1| hypothetical protein PRUPE_ppa005631mg [Prun... 57 3e-06 >ref|XP_002269218.1| PREDICTED: putative zinc metalloprotease slr1821-like isoform 2 [Vitis vinifera] Length = 426 Score = 62.4 bits (150), Expect = 6e-08 Identities = 31/50 (62%), Positives = 37/50 (74%) Frame = +2 Query: 275 LNTHYTEQFFYEKRRYPHRKRVSFRSFALPVFELGSLESAQSVIEAAGVL 424 L+ H FF EK RYPH KR +FRS+A+ F+ GSLESAQSV+EAA VL Sbjct: 55 LSFHSKNHFFCEKSRYPHGKRGNFRSWAMAGFDFGSLESAQSVVEAAAVL 104 >gb|EXB37885.1| Putative zinc metalloprotease [Morus notabilis] Length = 449 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/49 (57%), Positives = 36/49 (73%) Frame = +2 Query: 278 NTHYTEQFFYEKRRYPHRKRVSFRSFALPVFELGSLESAQSVIEAAGVL 424 N H +QFF+EK R PH KR F++ A+ F+ G+LESAQSV+EAA VL Sbjct: 49 NLHCKKQFFHEKSRNPHGKRFEFKTLAISGFDFGNLESAQSVLEAAAVL 97 >ref|XP_007215370.1| hypothetical protein PRUPE_ppa005631mg [Prunus persica] gi|462411520|gb|EMJ16569.1| hypothetical protein PRUPE_ppa005631mg [Prunus persica] Length = 450 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/44 (59%), Positives = 33/44 (75%) Frame = +2 Query: 293 EQFFYEKRRYPHRKRVSFRSFALPVFELGSLESAQSVIEAAGVL 424 E FF++K RYPH +R F S A+P F+ G+ ESAQSV+EAA VL Sbjct: 55 EPFFFQKGRYPHGRRFKFTSCAIPGFDYGNFESAQSVLEAAAVL 98