BLASTX nr result
ID: Cocculus22_contig00006146
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus22_contig00006146 (949 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003597210.1| Fasciclin-like arabinogalactan protein [Medi... 67 3e-10 >ref|XP_003597210.1| Fasciclin-like arabinogalactan protein [Medicago truncatula] gi|355486258|gb|AES67461.1| Fasciclin-like arabinogalactan protein [Medicago truncatula] Length = 335 Score = 67.0 bits (162), Expect(2) = 3e-10 Identities = 30/37 (81%), Positives = 32/37 (86%) Frame = +1 Query: 136 PSQQRRPSYCKVRLCPSPRTHSGSEEQLVQLLEQPRY 246 PS + P+YCKVRLCPSPR HSGSEE LVQLLEQPRY Sbjct: 299 PSNEDLPTYCKVRLCPSPRIHSGSEELLVQLLEQPRY 335 Score = 25.4 bits (54), Expect(2) = 3e-10 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +2 Query: 134 TRPSNEDLPT 163 TRPSNEDLPT Sbjct: 297 TRPSNEDLPT 306