BLASTX nr result
ID: Cocculus22_contig00006115
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus22_contig00006115 (573 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002268838.2| PREDICTED: cyclin-T1-5-like isoform 1 [Vitis... 55 1e-05 emb|CBI21689.3| unnamed protein product [Vitis vinifera] 55 1e-05 >ref|XP_002268838.2| PREDICTED: cyclin-T1-5-like isoform 1 [Vitis vinifera] Length = 623 Score = 55.5 bits (132), Expect = 1e-05 Identities = 24/33 (72%), Positives = 26/33 (78%) Frame = -3 Query: 100 MAGLLTGDPSCHGMVESGSFSFSQDKPDEVGRW 2 MAGLL GDPS HGM E GS+ F QDKP+E GRW Sbjct: 1 MAGLLPGDPSHHGMYEGGSYKFPQDKPEEGGRW 33 >emb|CBI21689.3| unnamed protein product [Vitis vinifera] Length = 539 Score = 55.5 bits (132), Expect = 1e-05 Identities = 24/33 (72%), Positives = 26/33 (78%) Frame = -3 Query: 100 MAGLLTGDPSCHGMVESGSFSFSQDKPDEVGRW 2 MAGLL GDPS HGM E GS+ F QDKP+E GRW Sbjct: 1 MAGLLPGDPSHHGMYEGGSYKFPQDKPEEGGRW 33