BLASTX nr result
ID: Cocculus22_contig00005882
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus22_contig00005882 (302 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN65986.1| hypothetical protein VITISV_042143 [Vitis vinifera] 72 5e-20 ref|XP_002534720.1| conserved hypothetical protein [Ricinus comm... 94 2e-17 ref|XP_003588351.1| Maturase [Medicago truncatula] gi|355477399|... 76 4e-12 >emb|CAN65986.1| hypothetical protein VITISV_042143 [Vitis vinifera] Length = 138 Score = 72.4 bits (176), Expect(2) = 5e-20 Identities = 38/58 (65%), Positives = 40/58 (68%) Frame = +1 Query: 1 KSNVHRPGE*GCSSVDRSSGLIGGGITPFSKEPYVTLSRHTAPSRNQDPSFPLTNGSS 174 +SNVH PG GGITPFSKEPYVTLSRHTAPSRN+D FPLTNGSS Sbjct: 13 ESNVHGPG---------------GGITPFSKEPYVTLSRHTAPSRNKDLPFPLTNGSS 55 Score = 50.8 bits (120), Expect(2) = 5e-20 Identities = 27/36 (75%), Positives = 29/36 (80%) Frame = +2 Query: 194 PFHSFID*FKVALACFQVQALAVEASRQKRTSGPGR 301 PF+S VA+ACFQVQALAVEASRQK TSGPGR Sbjct: 61 PFYS-----SVAVACFQVQALAVEASRQKLTSGPGR 91 >ref|XP_002534720.1| conserved hypothetical protein [Ricinus communis] gi|223524693|gb|EEF27662.1| conserved hypothetical protein [Ricinus communis] Length = 77 Score = 94.0 bits (232), Expect = 2e-17 Identities = 45/49 (91%), Positives = 45/49 (91%), Gaps = 1/49 (2%) Frame = +3 Query: 33 MQLRGPLVGPDRWWYHTLLKGTVRDTLASYGSVPESG-PLLSFDQRVLE 176 MQLRGPLVGPDRWWYHTLLKGTVRDTLASYGS PESG P SFDQRVLE Sbjct: 1 MQLRGPLVGPDRWWYHTLLKGTVRDTLASYGSAPESGPPPFSFDQRVLE 49 >ref|XP_003588351.1| Maturase [Medicago truncatula] gi|355477399|gb|AES58602.1| Maturase [Medicago truncatula] Length = 996 Score = 76.3 bits (186), Expect = 4e-12 Identities = 34/38 (89%), Positives = 36/38 (94%) Frame = -1 Query: 116 RESVTYGSFEKGVIPPPIRPDERSTELHPYSPGLCTLL 3 RE++TYGSFEKGV PPPIRPDERSTELHPYSPG CTLL Sbjct: 880 RENLTYGSFEKGVRPPPIRPDERSTELHPYSPGPCTLL 917