BLASTX nr result
ID: Cocculus22_contig00005862
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus22_contig00005862 (367 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB65075.1| hypothetical protein L484_004251 [Morus notabilis] 66 4e-09 >gb|EXB65075.1| hypothetical protein L484_004251 [Morus notabilis] Length = 298 Score = 66.2 bits (160), Expect = 4e-09 Identities = 39/96 (40%), Positives = 56/96 (58%), Gaps = 2/96 (2%) Frame = +1 Query: 25 PRRKIESDDKKEENWFWRHFSLQPSREYGPGYGEDFASVLAATAFAITSLEEEEHQKQLK 204 P+ + D KKE+NWF R FS Q SR+Y G++ +AA A+AI+SLEE Q + Sbjct: 32 PKPQPFKDKKKEQNWFQRKFSRQMSRDYDSSNGDEQGIAVAAAAYAISSLEEFGTPDQKQ 91 Query: 205 MRQERETSLKNNTTRKENGTAKLPIS--ISRRFSGK 306 +E TS ++KE+G +P S S+RFSG+ Sbjct: 92 RTKEPGTSTVATKSKKEDGIISIPDSGKDSKRFSGE 127