BLASTX nr result
ID: Cocculus22_contig00005654
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus22_contig00005654 (304 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006361868.1| PREDICTED: E3 ubiquitin-protein ligase ATL6-... 60 4e-07 ref|XP_004230173.1| PREDICTED: E3 ubiquitin-protein ligase ATL6-... 59 9e-07 ref|XP_007030911.1| RING/U-box superfamily protein, putative iso... 57 3e-06 >ref|XP_006361868.1| PREDICTED: E3 ubiquitin-protein ligase ATL6-like [Solanum tuberosum] Length = 433 Score = 59.7 bits (143), Expect = 4e-07 Identities = 36/77 (46%), Positives = 46/77 (59%), Gaps = 3/77 (3%) Frame = +3 Query: 24 TEQGARSDRWVFTRAPPFVSRASSVKSPKI--TDGEGSTRGNSRNFVTSVKTP-FDCIGS 194 +E +SDRW+FT APPF SR SS+KSP++ GEGST G+ R T+VK P F C+ Sbjct: 360 SEPEPKSDRWIFTMAPPFFSRGSSMKSPRVGAEAGEGSTSGSLR---TAVKLPSFKCLEP 416 Query: 195 KAAGTSQEEDATAHLPV 245 K S +A PV Sbjct: 417 KGDEASLMSTDSARPPV 433 >ref|XP_004230173.1| PREDICTED: E3 ubiquitin-protein ligase ATL6-like [Solanum lycopersicum] Length = 432 Score = 58.5 bits (140), Expect = 9e-07 Identities = 35/77 (45%), Positives = 45/77 (58%), Gaps = 3/77 (3%) Frame = +3 Query: 24 TEQGARSDRWVFTRAPPFVSRASSVKSPKI--TDGEGSTRGNSRNFVTSVKTP-FDCIGS 194 +E +SDRW+FT PPF SR SS+KSP++ GEGST G+ R T+VK P F C+ Sbjct: 359 SEPEPKSDRWIFTMTPPFFSRGSSMKSPRVGAEAGEGSTSGSMR---TAVKLPSFKCLEP 415 Query: 195 KAAGTSQEEDATAHLPV 245 K S +A PV Sbjct: 416 KGDEASLMSTDSARPPV 432 >ref|XP_007030911.1| RING/U-box superfamily protein, putative isoform 1 [Theobroma cacao] gi|590643833|ref|XP_007030912.1| RING/U-box superfamily protein, putative isoform 1 [Theobroma cacao] gi|508719516|gb|EOY11413.1| RING/U-box superfamily protein, putative isoform 1 [Theobroma cacao] gi|508719517|gb|EOY11414.1| RING/U-box superfamily protein, putative isoform 1 [Theobroma cacao] Length = 382 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/40 (65%), Positives = 32/40 (80%), Gaps = 2/40 (5%) Frame = +3 Query: 21 RTEQGARSDRWVFTRAPPFVSRASSVKSPKI--TDGEGST 134 R +QG +SDRWVF+ PPF SRASS+KSPK+ DGEGS+ Sbjct: 327 RLDQGVKSDRWVFSMTPPFFSRASSMKSPKVAANDGEGSS 366