BLASTX nr result
ID: Cocculus22_contig00005592
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus22_contig00005592 (369 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006445527.1| hypothetical protein CICLE_v10004111mg [Citr... 74 2e-11 ref|NP_671841.1| uncharacterized protein [Arabidopsis thaliana] ... 59 1e-08 ref|XP_003618685.1| Photosystem I assembly protein ycf3 [Medicag... 57 2e-06 >ref|XP_006445527.1| hypothetical protein CICLE_v10004111mg [Citrus clementina] gi|557547807|gb|ESR58767.1| hypothetical protein CICLE_v10004111mg [Citrus clementina] Length = 58 Score = 74.3 bits (181), Expect = 2e-11 Identities = 37/50 (74%), Positives = 37/50 (74%) Frame = +1 Query: 7 T*ESTPRKLCYIRNCPFPLIGIGTNKNGWDNKHPSRSYFGYSYNHRRLLK 156 T ES RKLCY P L GIGT KNGWDNKHPSRSY GY YNHRRLLK Sbjct: 11 TPESATRKLCY--KLPPFLSGIGTKKNGWDNKHPSRSYCGYPYNHRRLLK 58 >ref|NP_671841.1| uncharacterized protein [Arabidopsis thaliana] gi|330251116|gb|AEC06210.1| uncharacterized protein AT2G12905 [Arabidopsis thaliana] Length = 72 Score = 59.3 bits (142), Expect(2) = 1e-08 Identities = 23/29 (79%), Positives = 26/29 (89%) Frame = +1 Query: 55 FPLIGIGTNKNGWDNKHPSRSYFGYSYNH 141 F +GIGTN+NGW+NKHPSRSYFGY YNH Sbjct: 44 FFFVGIGTNQNGWNNKHPSRSYFGYPYNH 72 Score = 25.8 bits (55), Expect(2) = 1e-08 Identities = 9/12 (75%), Positives = 11/12 (91%) Frame = +2 Query: 2 TTPRNQHHENFV 37 TTPRNQ H+NF+ Sbjct: 25 TTPRNQQHKNFL 36 >ref|XP_003618685.1| Photosystem I assembly protein ycf3 [Medicago truncatula] gi|358344504|ref|XP_003636329.1| Photosystem I assembly protein ycf3 [Medicago truncatula] gi|358349399|ref|XP_003638725.1| Photosystem I assembly protein ycf3 [Medicago truncatula] gi|355493700|gb|AES74903.1| Photosystem I assembly protein ycf3 [Medicago truncatula] gi|355502264|gb|AES83467.1| Photosystem I assembly protein ycf3 [Medicago truncatula] gi|355504660|gb|AES85863.1| Photosystem I assembly protein ycf3 [Medicago truncatula] Length = 66 Score = 57.4 bits (137), Expect = 2e-06 Identities = 23/24 (95%), Positives = 23/24 (95%) Frame = +1 Query: 85 NGWDNKHPSRSYFGYSYNHRRLLK 156 NGWDNKHPSRSYFGY YNHRRLLK Sbjct: 43 NGWDNKHPSRSYFGYPYNHRRLLK 66