BLASTX nr result
ID: Cocculus22_contig00005242
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus22_contig00005242 (294 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001170758.1| uncharacterized protein LOC100384851 [Zea ma... 55 6e-08 ref|XP_003573893.1| PREDICTED: inositol-3-phosphate synthase-lik... 53 8e-08 ref|XP_002489230.1| hypothetical protein SORBIDRAFT_0012s002210 ... 54 1e-07 ref|XP_004983227.1| PREDICTED: inositol-3-phosphate synthase-lik... 52 1e-07 ref|XP_006826984.1| hypothetical protein AMTR_s00010p00205090 [A... 52 4e-07 gb|AFD61599.1| myo-inositol-1 phosphate synthase [Hevea brasilie... 50 4e-07 ref|NP_001265952.1| inositol-3-phosphate synthase-like [Cicer ar... 51 6e-07 ref|XP_003531361.1| PREDICTED: inositol-3-phosphate synthase [Gl... 50 6e-07 ref|XP_004143478.1| PREDICTED: inositol-3-phosphate synthase-lik... 50 8e-07 gb|ABC55421.1| myo-inositol-1-phosphate synthase [Glycine max] 49 8e-07 ref|XP_003525065.1| PREDICTED: inositol-3-phosphate synthase-lik... 49 8e-07 dbj|BAE71281.1| putative myo-inositol-1-phosphate synthase [Trif... 49 1e-06 gb|ADD09590.1| myo-inositol-1-phosphate synthase [Trifolium repens] 49 1e-06 ref|XP_003630058.1| L-myo inositol-1 phosphate synthase [Medicag... 49 1e-06 gb|ABO77439.1| myo-inositol-1-phosphate synthases [Medicago falc... 49 1e-06 ref|NP_001064454.1| Os10g0369900 [Oryza sativa Japonica Group] g... 50 1e-06 ref|XP_003630059.1| L-myo inositol-1 phosphate synthase [Medicag... 49 1e-06 gb|EAY78216.1| hypothetical protein OsI_33265 [Oryza sativa Indi... 50 1e-06 ref|XP_004149141.1| PREDICTED: inositol-3-phosphate synthase-lik... 50 2e-06 ref|XP_004163490.1| PREDICTED: inositol-3-phosphate synthase-lik... 50 2e-06 >ref|NP_001170758.1| uncharacterized protein LOC100384851 [Zea mays] gi|238007366|gb|ACR34718.1| unknown [Zea mays] gi|414868316|tpg|DAA46873.1| TPA: hypothetical protein ZEAMMB73_439271 [Zea mays] Length = 509 Score = 55.5 bits (132), Expect(2) = 6e-08 Identities = 33/52 (63%), Positives = 38/52 (73%), Gaps = 3/52 (5%) Frame = +2 Query: 2 NDAVEGLNDTMDNLLASLDKNELEISPSALYAFLLSWE-VHQVSGF--NTFL 148 ++ V GLNDTMDNLLASLDKNE EISPS LYA +E V V+G NTF+ Sbjct: 236 SNVVAGLNDTMDNLLASLDKNEAEISPSTLYAIACVFEGVPFVNGSPQNTFV 287 Score = 26.9 bits (58), Expect(2) = 6e-08 Identities = 11/14 (78%), Positives = 14/14 (100%) Frame = +1 Query: 211 IELAIKRNSLIGGD 252 +ELAIK+NS+IGGD Sbjct: 291 MELAIKKNSVIGGD 304 >ref|XP_003573893.1| PREDICTED: inositol-3-phosphate synthase-like [Brachypodium distachyon] Length = 508 Score = 52.8 bits (125), Expect(2) = 8e-08 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = +2 Query: 2 NDAVEGLNDTMDNLLASLDKNELEISPSALYA 97 +D V GLNDTMDNLLASLDKN EISPS++YA Sbjct: 235 SDVVVGLNDTMDNLLASLDKNMAEISPSSMYA 266 Score = 29.3 bits (64), Expect(2) = 8e-08 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = +1 Query: 211 IELAIKRNSLIGGD 252 IELAIK+NSLIGGD Sbjct: 290 IELAIKKNSLIGGD 303 >ref|XP_002489230.1| hypothetical protein SORBIDRAFT_0012s002210 [Sorghum bicolor] gi|241947090|gb|EES20235.1| hypothetical protein SORBIDRAFT_0012s002210 [Sorghum bicolor] Length = 519 Score = 54.3 bits (129), Expect(2) = 1e-07 Identities = 32/52 (61%), Positives = 38/52 (73%), Gaps = 3/52 (5%) Frame = +2 Query: 2 NDAVEGLNDTMDNLLASLDKNELEISPSALYAFLLSWE-VHQVSGF--NTFL 148 ++ V GLNDTMDNLLASL+KNE EISPS LYA +E V V+G NTF+ Sbjct: 246 SNVVSGLNDTMDNLLASLEKNEAEISPSTLYAIACVFEGVPFVNGSPQNTFV 297 Score = 26.9 bits (58), Expect(2) = 1e-07 Identities = 11/14 (78%), Positives = 14/14 (100%) Frame = +1 Query: 211 IELAIKRNSLIGGD 252 +ELAIK+NS+IGGD Sbjct: 301 MELAIKKNSVIGGD 314 >ref|XP_004983227.1| PREDICTED: inositol-3-phosphate synthase-like [Setaria italica] Length = 509 Score = 52.0 bits (123), Expect(2) = 1e-07 Identities = 24/32 (75%), Positives = 28/32 (87%) Frame = +2 Query: 2 NDAVEGLNDTMDNLLASLDKNELEISPSALYA 97 ++ V GLNDTMDNL+ASL+KNE EISPS LYA Sbjct: 236 SNVVTGLNDTMDNLMASLEKNEAEISPSTLYA 267 Score = 29.3 bits (64), Expect(2) = 1e-07 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = +1 Query: 211 IELAIKRNSLIGGD 252 IELAIK+NSLIGGD Sbjct: 291 IELAIKKNSLIGGD 304 >ref|XP_006826984.1| hypothetical protein AMTR_s00010p00205090 [Amborella trichopoda] gi|548831413|gb|ERM94221.1| hypothetical protein AMTR_s00010p00205090 [Amborella trichopoda] Length = 510 Score = 51.6 bits (122), Expect(2) = 4e-07 Identities = 23/32 (71%), Positives = 29/32 (90%) Frame = +2 Query: 2 NDAVEGLNDTMDNLLASLDKNELEISPSALYA 97 +D VEGLNDTM+NLLA++D+NE EISPS L+A Sbjct: 237 SDVVEGLNDTMENLLAAVDRNEAEISPSTLHA 268 Score = 28.1 bits (61), Expect(2) = 4e-07 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +1 Query: 211 IELAIKRNSLIGGD 252 IELAIK NSLIGGD Sbjct: 292 IELAIKTNSLIGGD 305 >gb|AFD61599.1| myo-inositol-1 phosphate synthase [Hevea brasiliensis] Length = 510 Score = 50.4 bits (119), Expect(2) = 4e-07 Identities = 24/38 (63%), Positives = 30/38 (78%) Frame = +2 Query: 2 NDAVEGLNDTMDNLLASLDKNELEISPSALYAFLLSWE 115 ++ V GLNDTM+NLLA+L+KNE EISPS LYA +E Sbjct: 237 SNVVVGLNDTMENLLAALEKNEAEISPSTLYALACVFE 274 Score = 29.3 bits (64), Expect(2) = 4e-07 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = +1 Query: 211 IELAIKRNSLIGGD 252 I+LAIKRNSLIGGD Sbjct: 292 IDLAIKRNSLIGGD 305 >ref|NP_001265952.1| inositol-3-phosphate synthase-like [Cicer arietinum] gi|198401804|gb|ACH87553.1| L-myo inositol-1 phosphate synthase 2 [Cicer arietinum] Length = 510 Score = 51.2 bits (121), Expect(2) = 6e-07 Identities = 24/32 (75%), Positives = 28/32 (87%) Frame = +2 Query: 2 NDAVEGLNDTMDNLLASLDKNELEISPSALYA 97 ++ V GLNDTM+NLLAS+DKNE EISPS LYA Sbjct: 237 SNVVVGLNDTMENLLASVDKNEAEISPSTLYA 268 Score = 27.7 bits (60), Expect(2) = 6e-07 Identities = 12/14 (85%), Positives = 14/14 (100%) Frame = +1 Query: 211 IELAIKRNSLIGGD 252 I+LAI+RNSLIGGD Sbjct: 292 IDLAIQRNSLIGGD 305 >ref|XP_003531361.1| PREDICTED: inositol-3-phosphate synthase [Glycine max] gi|84311239|gb|ABC55422.1| myo-inositol-1-phosphate synthase [Glycine max] Length = 510 Score = 49.7 bits (117), Expect(2) = 6e-07 Identities = 23/32 (71%), Positives = 27/32 (84%) Frame = +2 Query: 2 NDAVEGLNDTMDNLLASLDKNELEISPSALYA 97 ++ V GLNDTM+NL ASLD+NE EISPS LYA Sbjct: 237 SNVVVGLNDTMENLFASLDRNEAEISPSTLYA 268 Score = 29.3 bits (64), Expect(2) = 6e-07 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = +1 Query: 211 IELAIKRNSLIGGD 252 I+LAIKRNSLIGGD Sbjct: 292 IDLAIKRNSLIGGD 305 >ref|XP_004143478.1| PREDICTED: inositol-3-phosphate synthase-like [Cucumis sativus] gi|449504829|ref|XP_004162306.1| PREDICTED: inositol-3-phosphate synthase-like [Cucumis sativus] Length = 510 Score = 50.4 bits (119), Expect(2) = 8e-07 Identities = 24/32 (75%), Positives = 28/32 (87%) Frame = +2 Query: 2 NDAVEGLNDTMDNLLASLDKNELEISPSALYA 97 ++ V GLNDTM++LLASLDKNE EISPS LYA Sbjct: 237 SNVVVGLNDTMESLLASLDKNEAEISPSTLYA 268 Score = 28.1 bits (61), Expect(2) = 8e-07 Identities = 12/14 (85%), Positives = 14/14 (100%) Frame = +1 Query: 211 IELAIKRNSLIGGD 252 I+LAI+RNSLIGGD Sbjct: 292 IDLAIRRNSLIGGD 305 >gb|ABC55421.1| myo-inositol-1-phosphate synthase [Glycine max] Length = 510 Score = 49.3 bits (116), Expect(2) = 8e-07 Identities = 23/32 (71%), Positives = 27/32 (84%) Frame = +2 Query: 2 NDAVEGLNDTMDNLLASLDKNELEISPSALYA 97 ++ V GLNDTM+NL ASLD+NE EISPS LYA Sbjct: 237 SNLVVGLNDTMENLFASLDRNEAEISPSTLYA 268 Score = 29.3 bits (64), Expect(2) = 8e-07 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = +1 Query: 211 IELAIKRNSLIGGD 252 I+LAIKRNSLIGGD Sbjct: 292 IDLAIKRNSLIGGD 305 >ref|XP_003525065.1| PREDICTED: inositol-3-phosphate synthase-like [Glycine max] Length = 510 Score = 49.3 bits (116), Expect(2) = 8e-07 Identities = 23/32 (71%), Positives = 27/32 (84%) Frame = +2 Query: 2 NDAVEGLNDTMDNLLASLDKNELEISPSALYA 97 ++ V GLNDTM+NL ASLD+NE EISPS LYA Sbjct: 237 SNLVVGLNDTMENLFASLDRNEAEISPSTLYA 268 Score = 29.3 bits (64), Expect(2) = 8e-07 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = +1 Query: 211 IELAIKRNSLIGGD 252 I+LAIKRNSLIGGD Sbjct: 292 IDLAIKRNSLIGGD 305 >dbj|BAE71281.1| putative myo-inositol-1-phosphate synthase [Trifolium pratense] gi|84468400|dbj|BAE71283.1| putative myo-inositol-1-phosphate synthase [Trifolium pratense] Length = 511 Score = 48.9 bits (115), Expect(2) = 1e-06 Identities = 23/32 (71%), Positives = 28/32 (87%) Frame = +2 Query: 2 NDAVEGLNDTMDNLLASLDKNELEISPSALYA 97 ++ V GLNDTM+NLLAS+DKNE EISPS L+A Sbjct: 238 SNIVVGLNDTMENLLASVDKNESEISPSTLFA 269 Score = 29.3 bits (64), Expect(2) = 1e-06 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = +1 Query: 211 IELAIKRNSLIGGD 252 I+LAIKRNSLIGGD Sbjct: 293 IDLAIKRNSLIGGD 306 >gb|ADD09590.1| myo-inositol-1-phosphate synthase [Trifolium repens] Length = 511 Score = 48.9 bits (115), Expect(2) = 1e-06 Identities = 23/32 (71%), Positives = 28/32 (87%) Frame = +2 Query: 2 NDAVEGLNDTMDNLLASLDKNELEISPSALYA 97 ++ V GLNDTM+NLLAS+DKNE EISPS L+A Sbjct: 238 SNIVVGLNDTMENLLASVDKNESEISPSTLFA 269 Score = 29.3 bits (64), Expect(2) = 1e-06 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = +1 Query: 211 IELAIKRNSLIGGD 252 I+LAIKRNSLIGGD Sbjct: 293 IDLAIKRNSLIGGD 306 >ref|XP_003630058.1| L-myo inositol-1 phosphate synthase [Medicago truncatula] gi|355524080|gb|AET04534.1| L-myo inositol-1 phosphate synthase [Medicago truncatula] Length = 510 Score = 48.5 bits (114), Expect(2) = 1e-06 Identities = 23/32 (71%), Positives = 27/32 (84%) Frame = +2 Query: 2 NDAVEGLNDTMDNLLASLDKNELEISPSALYA 97 ++ V GLNDT +NLLAS+DKNE EISPS LYA Sbjct: 237 SNIVVGLNDTTENLLASVDKNEAEISPSTLYA 268 Score = 29.3 bits (64), Expect(2) = 1e-06 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = +1 Query: 211 IELAIKRNSLIGGD 252 I+LAIKRNSLIGGD Sbjct: 292 IDLAIKRNSLIGGD 305 >gb|ABO77439.1| myo-inositol-1-phosphate synthases [Medicago falcata] Length = 510 Score = 48.5 bits (114), Expect(2) = 1e-06 Identities = 23/32 (71%), Positives = 27/32 (84%) Frame = +2 Query: 2 NDAVEGLNDTMDNLLASLDKNELEISPSALYA 97 ++ V GLNDT +NLLAS+DKNE EISPS LYA Sbjct: 237 SNIVVGLNDTTENLLASVDKNEAEISPSTLYA 268 Score = 29.3 bits (64), Expect(2) = 1e-06 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = +1 Query: 211 IELAIKRNSLIGGD 252 I+LAIKRNSLIGGD Sbjct: 292 IDLAIKRNSLIGGD 305 >ref|NP_001064454.1| Os10g0369900 [Oryza sativa Japonica Group] gi|20043019|gb|AAM08827.1|AC113335_7 Putative Myo-inositol-1-phosphate synthase (MI-1-P synthase) [Oryza sativa Japonica Group] gi|31431622|gb|AAP53373.1| Inositol-3-phosphate synthase, putative, expressed [Oryza sativa Japonica Group] gi|113639063|dbj|BAF26368.1| Os10g0369900 [Oryza sativa Japonica Group] gi|125531652|gb|EAY78217.1| hypothetical protein OsI_33266 [Oryza sativa Indica Group] gi|125574563|gb|EAZ15847.1| hypothetical protein OsJ_31267 [Oryza sativa Japonica Group] Length = 509 Score = 49.7 bits (117), Expect(2) = 1e-06 Identities = 23/32 (71%), Positives = 28/32 (87%) Frame = +2 Query: 2 NDAVEGLNDTMDNLLASLDKNELEISPSALYA 97 ++ V G+NDTMDNLLASLDK+E E+SPS LYA Sbjct: 236 SNVVAGMNDTMDNLLASLDKDEPEMSPSTLYA 267 Score = 28.1 bits (61), Expect(2) = 1e-06 Identities = 12/14 (85%), Positives = 14/14 (100%) Frame = +1 Query: 211 IELAIKRNSLIGGD 252 IELAIK+NS+IGGD Sbjct: 291 IELAIKKNSVIGGD 304 >ref|XP_003630059.1| L-myo inositol-1 phosphate synthase [Medicago truncatula] gi|355524081|gb|AET04535.1| L-myo inositol-1 phosphate synthase [Medicago truncatula] Length = 300 Score = 48.5 bits (114), Expect(2) = 1e-06 Identities = 23/32 (71%), Positives = 27/32 (84%) Frame = +2 Query: 2 NDAVEGLNDTMDNLLASLDKNELEISPSALYA 97 ++ V GLNDT +NLLAS+DKNE EISPS LYA Sbjct: 27 SNIVVGLNDTTENLLASVDKNEAEISPSTLYA 58 Score = 29.3 bits (64), Expect(2) = 1e-06 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = +1 Query: 211 IELAIKRNSLIGGD 252 I+LAIKRNSLIGGD Sbjct: 82 IDLAIKRNSLIGGD 95 >gb|EAY78216.1| hypothetical protein OsI_33265 [Oryza sativa Indica Group] Length = 259 Score = 49.7 bits (117), Expect(2) = 1e-06 Identities = 23/32 (71%), Positives = 28/32 (87%) Frame = +2 Query: 2 NDAVEGLNDTMDNLLASLDKNELEISPSALYA 97 ++ V G+NDTMDNLLASLDK+E E+SPS LYA Sbjct: 108 SNVVAGMNDTMDNLLASLDKDEPEMSPSTLYA 139 Score = 28.1 bits (61), Expect(2) = 1e-06 Identities = 12/14 (85%), Positives = 14/14 (100%) Frame = +1 Query: 211 IELAIKRNSLIGGD 252 IELAIK+NS+IGGD Sbjct: 163 IELAIKKNSVIGGD 176 >ref|XP_004149141.1| PREDICTED: inositol-3-phosphate synthase-like [Cucumis sativus] Length = 523 Score = 50.4 bits (119), Expect(2) = 2e-06 Identities = 23/32 (71%), Positives = 28/32 (87%) Frame = +2 Query: 2 NDAVEGLNDTMDNLLASLDKNELEISPSALYA 97 ++ + GLNDTM+NLLAS+DKNE EISPS LYA Sbjct: 250 SNVIVGLNDTMENLLASVDKNESEISPSTLYA 281 Score = 26.9 bits (58), Expect(2) = 2e-06 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +1 Query: 211 IELAIKRNSLIGGD 252 I+LAI RNSLIGGD Sbjct: 305 IDLAIHRNSLIGGD 318 >ref|XP_004163490.1| PREDICTED: inositol-3-phosphate synthase-like [Cucumis sativus] Length = 510 Score = 50.4 bits (119), Expect(2) = 2e-06 Identities = 23/32 (71%), Positives = 28/32 (87%) Frame = +2 Query: 2 NDAVEGLNDTMDNLLASLDKNELEISPSALYA 97 ++ + GLNDTM+NLLAS+DKNE EISPS LYA Sbjct: 237 SNVIVGLNDTMENLLASVDKNESEISPSTLYA 268 Score = 26.9 bits (58), Expect(2) = 2e-06 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +1 Query: 211 IELAIKRNSLIGGD 252 I+LAI RNSLIGGD Sbjct: 292 IDLAIHRNSLIGGD 305