BLASTX nr result
ID: Cocculus22_contig00004619
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus22_contig00004619 (558 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007020056.1| Chaperone DnaJ-domain superfamily protein, p... 65 2e-08 ref|XP_006302986.1| hypothetical protein CARUB_v10021139mg [Caps... 62 1e-07 gb|AAM63520.1| DnaJ protein, putative [Arabidopsis thaliana] 59 2e-07 ref|NP_565034.1| chaperone DnaJ-domain containing protein [Arabi... 58 5e-07 >ref|XP_007020056.1| Chaperone DnaJ-domain superfamily protein, putative [Theobroma cacao] gi|508725384|gb|EOY17281.1| Chaperone DnaJ-domain superfamily protein, putative [Theobroma cacao] Length = 132 Score = 64.7 bits (156), Expect = 2e-08 Identities = 38/76 (50%), Positives = 48/76 (63%), Gaps = 3/76 (3%) Frame = -2 Query: 518 RSGFGGARRARTTFWTSNPKSDRCVRFP--ARSLP-FSEAFSVLGLTPFASKFDVKQAYK 348 R G GA + T + R +R P R P F+ +++LGLTPFASK DVKQAYK Sbjct: 8 RLGLRGANHQQLT------STRRGLRIPIICRCFPNFTTHYALLGLTPFASKSDVKQAYK 61 Query: 347 RLALKYHPDVIRGDSL 300 RLALKYHPDV +G+ + Sbjct: 62 RLALKYHPDVYKGEDV 77 >ref|XP_006302986.1| hypothetical protein CARUB_v10021139mg [Capsella rubella] gi|482571696|gb|EOA35884.1| hypothetical protein CARUB_v10021139mg [Capsella rubella] Length = 131 Score = 61.6 bits (148), Expect = 1e-07 Identities = 30/51 (58%), Positives = 40/51 (78%), Gaps = 1/51 (1%) Frame = -2 Query: 458 SDRCVRFPAR-SLPFSEAFSVLGLTPFASKFDVKQAYKRLALKYHPDVIRG 309 S+R +RFP R S P +++LGLTP AS+ +VK+A+KRLALKYHPDV +G Sbjct: 24 SNRLIRFPTRCSSPDLSHYTILGLTPLASQTEVKRAFKRLALKYHPDVHKG 74 >gb|AAM63520.1| DnaJ protein, putative [Arabidopsis thaliana] Length = 126 Score = 59.3 bits (142), Expect(2) = 2e-07 Identities = 31/57 (54%), Positives = 39/57 (68%), Gaps = 2/57 (3%) Frame = -2 Query: 473 TSNPKSDRCVRFPARSL--PFSEAFSVLGLTPFASKFDVKQAYKRLALKYHPDVIRG 309 T S R +RFP R P ++VLGLTP AS+ +VK+A+KRLALKYHPDV +G Sbjct: 17 TIQTDSRRLIRFPTRCCLSPDLSHYTVLGLTPLASQTEVKRAFKRLALKYHPDVHKG 73 Score = 21.9 bits (45), Expect(2) = 2e-07 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = -1 Query: 216 MGFEGGIP 193 MGFEGGIP Sbjct: 114 MGFEGGIP 121 >ref|NP_565034.1| chaperone DnaJ-domain containing protein [Arabidopsis thaliana] gi|332197149|gb|AEE35270.1| chaperone DnaJ-domain containing protein [Arabidopsis thaliana] Length = 126 Score = 57.8 bits (138), Expect(2) = 5e-07 Identities = 30/57 (52%), Positives = 39/57 (68%), Gaps = 2/57 (3%) Frame = -2 Query: 473 TSNPKSDRCVRFPARSL--PFSEAFSVLGLTPFASKFDVKQAYKRLALKYHPDVIRG 309 T S R ++FP R P ++VLGLTP AS+ +VK+A+KRLALKYHPDV +G Sbjct: 17 TIQTDSRRLIQFPTRCCLSPDLSHYTVLGLTPLASQTEVKRAFKRLALKYHPDVHKG 73 Score = 21.9 bits (45), Expect(2) = 5e-07 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = -1 Query: 216 MGFEGGIP 193 MGFEGGIP Sbjct: 114 MGFEGGIP 121