BLASTX nr result
ID: Cocculus22_contig00004103
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus22_contig00004103 (559 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004145344.1| PREDICTED: mitochondrial import receptor sub... 71 2e-10 gb|ABK20892.1| unknown [Picea sitchensis] gi|116784174|gb|ABK232... 69 6e-10 gb|EYU37743.1| hypothetical protein MIMGU_mgv1a016428mg [Mimulus... 68 1e-09 gb|EXB63635.1| hypothetical protein L484_026977 [Morus notabilis] 68 1e-09 ref|XP_007019163.1| Translocase of the outer mitochondrial membr... 68 2e-09 ref|XP_007131882.1| hypothetical protein PHAVU_011G049200g [Phas... 67 2e-09 ref|XP_006423157.1| hypothetical protein CICLE_v10029767mg [Citr... 66 7e-09 gb|EPS68378.1| hypothetical protein M569_06396, partial [Genlise... 65 1e-08 ref|XP_002313822.1| hypothetical protein POPTR_0009s11330g [Popu... 64 2e-08 ref|XP_002305407.1| Mitochondrial import receptor subunit TOM6 f... 64 2e-08 ref|XP_006590915.1| PREDICTED: mitochondrial import receptor sub... 64 3e-08 ref|XP_004230848.1| PREDICTED: mitochondrial import receptor sub... 64 3e-08 ref|XP_003541100.1| PREDICTED: mitochondrial import receptor sub... 64 3e-08 ref|XP_002519115.1| conserved hypothetical protein [Ricinus comm... 64 3e-08 ref|XP_004492183.1| PREDICTED: mitochondrial import receptor sub... 62 8e-08 ref|XP_006592291.1| PREDICTED: mitochondrial import receptor sub... 61 2e-07 ref|NP_564545.1| translocase of the outer mitochondrial membrane... 57 3e-06 ref|XP_002894180.1| hypothetical protein ARALYDRAFT_891816 [Arab... 57 3e-06 gb|ACF79903.1| unknown [Zea mays] gi|414871850|tpg|DAA50407.1| T... 57 4e-06 ref|XP_002466788.1| hypothetical protein SORBIDRAFT_01g014240 [S... 56 7e-06 >ref|XP_004145344.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Cucumis sativus] gi|449455208|ref|XP_004145345.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Cucumis sativus] gi|449474805|ref|XP_004154290.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Cucumis sativus] gi|449474809|ref|XP_004154291.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Cucumis sativus] gi|449532212|ref|XP_004173076.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Cucumis sativus] gi|449532214|ref|XP_004173077.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Cucumis sativus] Length = 54 Score = 71.2 bits (173), Expect = 2e-10 Identities = 31/42 (73%), Positives = 36/42 (85%) Frame = -3 Query: 455 MILGAIPRRPEKAAALKQLRSHVTMFGIWVAIVRVTPYVLHY 330 M G R+P+KAAALKQLRSHV MFG+WVA++RVTPYVLHY Sbjct: 1 MFPGMFMRKPDKAAALKQLRSHVAMFGVWVAVIRVTPYVLHY 42 >gb|ABK20892.1| unknown [Picea sitchensis] gi|116784174|gb|ABK23244.1| unknown [Picea sitchensis] gi|116789568|gb|ABK25295.1| unknown [Picea sitchensis] Length = 55 Score = 69.3 bits (168), Expect = 6e-10 Identities = 30/42 (71%), Positives = 35/42 (83%) Frame = -3 Query: 455 MILGAIPRRPEKAAALKQLRSHVTMFGIWVAIVRVTPYVLHY 330 M LGAIPRRP+KAAA KQLR H+T+ GIWVA +RV PYV H+ Sbjct: 1 MFLGAIPRRPDKAAAYKQLRKHLTLLGIWVAAIRVAPYVAHF 42 >gb|EYU37743.1| hypothetical protein MIMGU_mgv1a016428mg [Mimulus guttatus] Length = 122 Score = 68.2 bits (165), Expect = 1e-09 Identities = 29/44 (65%), Positives = 35/44 (79%) Frame = -3 Query: 461 EKMILGAIPRRPEKAAALKQLRSHVTMFGIWVAIVRVTPYVLHY 330 +KM G R+P+KAAALKQLRSH MFG WVA++RV PY+LHY Sbjct: 67 KKMFPGMFMRKPDKAAALKQLRSHAAMFGAWVAVIRVAPYILHY 110 >gb|EXB63635.1| hypothetical protein L484_026977 [Morus notabilis] Length = 54 Score = 68.2 bits (165), Expect = 1e-09 Identities = 29/42 (69%), Positives = 35/42 (83%) Frame = -3 Query: 455 MILGAIPRRPEKAAALKQLRSHVTMFGIWVAIVRVTPYVLHY 330 M G R+P+KAAALKQLR+HV MFG WVA++RVTPY+LHY Sbjct: 1 MFPGMFMRKPDKAAALKQLRTHVAMFGAWVAVIRVTPYILHY 42 >ref|XP_007019163.1| Translocase of the outer mitochondrial membrane 6 [Theobroma cacao] gi|508724491|gb|EOY16388.1| Translocase of the outer mitochondrial membrane 6 [Theobroma cacao] Length = 54 Score = 67.8 bits (164), Expect = 2e-09 Identities = 29/42 (69%), Positives = 35/42 (83%) Frame = -3 Query: 455 MILGAIPRRPEKAAALKQLRSHVTMFGIWVAIVRVTPYVLHY 330 M G R+P+KAAALKQL+ HV MFG+WVA+VRVTPY+LHY Sbjct: 1 MFPGMFMRKPDKAAALKQLKVHVAMFGVWVAVVRVTPYILHY 42 >ref|XP_007131882.1| hypothetical protein PHAVU_011G049200g [Phaseolus vulgaris] gi|561004882|gb|ESW03876.1| hypothetical protein PHAVU_011G049200g [Phaseolus vulgaris] Length = 54 Score = 67.4 bits (163), Expect = 2e-09 Identities = 29/42 (69%), Positives = 35/42 (83%) Frame = -3 Query: 455 MILGAIPRRPEKAAALKQLRSHVTMFGIWVAIVRVTPYVLHY 330 M G R+P+KAAALKQL+SHVTMFG WV ++RVTPYVLH+ Sbjct: 1 MFPGMFMRKPDKAAALKQLKSHVTMFGAWVVVIRVTPYVLHF 42 >ref|XP_006423157.1| hypothetical protein CICLE_v10029767mg [Citrus clementina] gi|567861008|ref|XP_006423158.1| hypothetical protein CICLE_v10029767mg [Citrus clementina] gi|568851345|ref|XP_006479354.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog isoform X1 [Citrus sinensis] gi|568851347|ref|XP_006479355.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog isoform X2 [Citrus sinensis] gi|557525091|gb|ESR36397.1| hypothetical protein CICLE_v10029767mg [Citrus clementina] gi|557525092|gb|ESR36398.1| hypothetical protein CICLE_v10029767mg [Citrus clementina] Length = 54 Score = 65.9 bits (159), Expect = 7e-09 Identities = 28/42 (66%), Positives = 34/42 (80%) Frame = -3 Query: 455 MILGAIPRRPEKAAALKQLRSHVTMFGIWVAIVRVTPYVLHY 330 M G ++P+KAAALKQLRSHV MFG WV ++RVTPY+LHY Sbjct: 1 MFPGMFMKKPDKAAALKQLRSHVAMFGTWVVVIRVTPYLLHY 42 >gb|EPS68378.1| hypothetical protein M569_06396, partial [Genlisea aurea] Length = 54 Score = 65.1 bits (157), Expect = 1e-08 Identities = 28/43 (65%), Positives = 33/43 (76%) Frame = -3 Query: 458 KMILGAIPRRPEKAAALKQLRSHVTMFGIWVAIVRVTPYVLHY 330 KM G R+P+KAAALKQL+SH MFG W+A+VR PYVLHY Sbjct: 1 KMFPGMFMRKPDKAAALKQLKSHAIMFGAWIAVVRAAPYVLHY 43 >ref|XP_002313822.1| hypothetical protein POPTR_0009s11330g [Populus trichocarpa] gi|118483621|gb|ABK93705.1| unknown [Populus trichocarpa] gi|222850230|gb|EEE87777.1| hypothetical protein POPTR_0009s11330g [Populus trichocarpa] Length = 54 Score = 64.3 bits (155), Expect = 2e-08 Identities = 28/42 (66%), Positives = 33/42 (78%) Frame = -3 Query: 455 MILGAIPRRPEKAAALKQLRSHVTMFGIWVAIVRVTPYVLHY 330 M G ++P+KA ALKQLRSHV MFG WV ++RVTPYVLHY Sbjct: 1 MFPGLFMKKPDKAEALKQLRSHVAMFGAWVVVLRVTPYVLHY 42 >ref|XP_002305407.1| Mitochondrial import receptor subunit TOM6 family protein [Populus trichocarpa] gi|118484423|gb|ABK94088.1| unknown [Populus trichocarpa] gi|222848371|gb|EEE85918.1| Mitochondrial import receptor subunit TOM6 family protein [Populus trichocarpa] Length = 54 Score = 64.3 bits (155), Expect = 2e-08 Identities = 28/42 (66%), Positives = 33/42 (78%) Frame = -3 Query: 455 MILGAIPRRPEKAAALKQLRSHVTMFGIWVAIVRVTPYVLHY 330 M G R+P+KA ALKQL+SHV MFG WV ++RVTPYVLHY Sbjct: 1 MFPGMFMRKPDKAEALKQLKSHVAMFGAWVVVLRVTPYVLHY 42 >ref|XP_006590915.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Glycine max] Length = 54 Score = 63.9 bits (154), Expect = 3e-08 Identities = 27/42 (64%), Positives = 33/42 (78%) Frame = -3 Query: 455 MILGAIPRRPEKAAALKQLRSHVTMFGIWVAIVRVTPYVLHY 330 M G R+P+KAAALKQL+SH MFG WV ++RVTPYVLH+ Sbjct: 1 MFPGMFMRKPDKAAALKQLKSHAAMFGAWVVVIRVTPYVLHF 42 >ref|XP_004230848.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Solanum lycopersicum] gi|565399930|ref|XP_006365492.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Solanum tuberosum] Length = 54 Score = 63.9 bits (154), Expect = 3e-08 Identities = 26/42 (61%), Positives = 34/42 (80%) Frame = -3 Query: 455 MILGAIPRRPEKAAALKQLRSHVTMFGIWVAIVRVTPYVLHY 330 M G R+P+KAAALKQL++HV +FG WVA++RV PY+LHY Sbjct: 1 MFPGMFMRKPDKAAALKQLKTHVVLFGTWVAVIRVAPYILHY 42 >ref|XP_003541100.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog isoform 1 [Glycine max] gi|255626599|gb|ACU13644.1| unknown [Glycine max] Length = 54 Score = 63.9 bits (154), Expect = 3e-08 Identities = 27/42 (64%), Positives = 33/42 (78%) Frame = -3 Query: 455 MILGAIPRRPEKAAALKQLRSHVTMFGIWVAIVRVTPYVLHY 330 M G R+P+KAAALKQL+SH MFG WV ++RVTPYVLH+ Sbjct: 1 MFPGMFMRKPDKAAALKQLKSHAAMFGTWVVVIRVTPYVLHF 42 >ref|XP_002519115.1| conserved hypothetical protein [Ricinus communis] gi|223541778|gb|EEF43326.1| conserved hypothetical protein [Ricinus communis] Length = 54 Score = 63.9 bits (154), Expect = 3e-08 Identities = 27/42 (64%), Positives = 34/42 (80%) Frame = -3 Query: 455 MILGAIPRRPEKAAALKQLRSHVTMFGIWVAIVRVTPYVLHY 330 M G R+P+KAAALKQL++H +FG WVA++RVTPYVLHY Sbjct: 1 MFPGMFMRKPDKAAALKQLKTHAAIFGAWVALIRVTPYVLHY 42 >ref|XP_004492183.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Cicer arietinum] Length = 54 Score = 62.4 bits (150), Expect = 8e-08 Identities = 26/42 (61%), Positives = 33/42 (78%) Frame = -3 Query: 455 MILGAIPRRPEKAAALKQLRSHVTMFGIWVAIVRVTPYVLHY 330 M G R+P+KAAALKQL+SHV MFG WV ++RV PY+L+Y Sbjct: 1 MFPGMFMRKPDKAAALKQLKSHVAMFGTWVVVIRVAPYILYY 42 >ref|XP_006592291.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Glycine max] Length = 83 Score = 60.8 bits (146), Expect = 2e-07 Identities = 26/42 (61%), Positives = 33/42 (78%) Frame = -3 Query: 455 MILGAIPRRPEKAAALKQLRSHVTMFGIWVAIVRVTPYVLHY 330 M G R+P+KAAALKQL+SHV MF WV +++VTPYVLH+ Sbjct: 1 MFPGMFMRKPDKAAALKQLKSHVVMFQAWVVVIQVTPYVLHF 42 >ref|NP_564545.1| translocase of the outer mitochondrial membrane 6 [Arabidopsis thaliana] gi|46577137|sp|Q9XIA7.1|TOM6_ARATH RecName: Full=Mitochondrial import receptor subunit TOM6 homolog; AltName: Full=Translocase of outer membrane 6 kDa subunit homolog gi|5430759|gb|AAD43159.1|AC007504_14 Unknown Protein [Arabidopsis thaliana] gi|11692924|gb|AAG40065.1|AF324714_1 At1g49410 [Arabidopsis thaliana] gi|11762280|gb|AAG40411.1|AF325059_1 At1g49410 [Arabidopsis thaliana] gi|11935199|gb|AAG42015.1|AF327425_1 unknown protein [Arabidopsis thaliana] gi|12642920|gb|AAK00402.1|AF339720_1 unknown protein [Arabidopsis thaliana] gi|14335020|gb|AAK59774.1| At1g49410/F13F21_16 [Arabidopsis thaliana] gi|27363338|gb|AAO11588.1| At1g49410/F13F21_16 [Arabidopsis thaliana] gi|332194306|gb|AEE32427.1| translocase of the outer mitochondrial membrane 6 [Arabidopsis thaliana] Length = 54 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/42 (59%), Positives = 30/42 (71%) Frame = -3 Query: 455 MILGAIPRRPEKAAALKQLRSHVTMFGIWVAIVRVTPYVLHY 330 M G R+P+KA ALKQLR+HV +FG WV I+R PYVL Y Sbjct: 1 MFPGMFMRKPDKAEALKQLRTHVALFGSWVVIIRAAPYVLSY 42 >ref|XP_002894180.1| hypothetical protein ARALYDRAFT_891816 [Arabidopsis lyrata subsp. lyrata] gi|297340022|gb|EFH70439.1| hypothetical protein ARALYDRAFT_891816 [Arabidopsis lyrata subsp. lyrata] Length = 54 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/42 (61%), Positives = 30/42 (71%) Frame = -3 Query: 455 MILGAIPRRPEKAAALKQLRSHVTMFGIWVAIVRVTPYVLHY 330 M G R+P+KA ALKQLR+HV +FG WV IVR PYVL Y Sbjct: 1 MFPGMFMRKPDKAVALKQLRTHVALFGGWVVIVRAVPYVLSY 42 >gb|ACF79903.1| unknown [Zea mays] gi|414871850|tpg|DAA50407.1| TPA: hypothetical protein ZEAMMB73_336113 [Zea mays] Length = 56 Score = 56.6 bits (135), Expect = 4e-06 Identities = 23/42 (54%), Positives = 31/42 (73%) Frame = -3 Query: 455 MILGAIPRRPEKAAALKQLRSHVTMFGIWVAIVRVTPYVLHY 330 M LG++PRRP K AA KQLRSH+ + A++R TPY+LH+ Sbjct: 1 MFLGSLPRRPSKEAAYKQLRSHIIIMASCAAVIRATPYILHF 42 >ref|XP_002466788.1| hypothetical protein SORBIDRAFT_01g014240 [Sorghum bicolor] gi|241920642|gb|EER93786.1| hypothetical protein SORBIDRAFT_01g014240 [Sorghum bicolor] Length = 56 Score = 55.8 bits (133), Expect = 7e-06 Identities = 23/42 (54%), Positives = 30/42 (71%) Frame = -3 Query: 455 MILGAIPRRPEKAAALKQLRSHVTMFGIWVAIVRVTPYVLHY 330 M LGA+PRRP K AA KQLRSH+ + A++R PY+LH+ Sbjct: 1 MFLGAVPRRPSKEAAYKQLRSHLVIMASCAAVIRAAPYILHF 42