BLASTX nr result
ID: Cocculus22_contig00002534
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus22_contig00002534 (386 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006427974.1| hypothetical protein CICLE_v10027018mg [Citr... 55 8e-06 >ref|XP_006427974.1| hypothetical protein CICLE_v10027018mg [Citrus clementina] gi|568820706|ref|XP_006464847.1| PREDICTED: codeine O-demethylase-like [Citrus sinensis] gi|557529964|gb|ESR41214.1| hypothetical protein CICLE_v10027018mg [Citrus clementina] Length = 342 Score = 55.5 bits (132), Expect = 8e-06 Identities = 22/37 (59%), Positives = 28/37 (75%) Frame = -2 Query: 382 SEDQILEWFDRLSLLIKPEDEKNLKLWPENPSCFRYV 272 S+DQ +W DRL L+ KPED++ LKLWPENP FR + Sbjct: 121 SKDQAFDWIDRLHLVTKPEDKRQLKLWPENPQSFREI 157