BLASTX nr result
ID: Cocculus22_contig00002367
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus22_contig00002367 (280 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007214989.1| hypothetical protein PRUPE_ppa002194mg [Prun... 56 6e-06 >ref|XP_007214989.1| hypothetical protein PRUPE_ppa002194mg [Prunus persica] gi|462411139|gb|EMJ16188.1| hypothetical protein PRUPE_ppa002194mg [Prunus persica] Length = 703 Score = 55.8 bits (133), Expect = 6e-06 Identities = 42/106 (39%), Positives = 53/106 (50%), Gaps = 14/106 (13%) Frame = +2 Query: 5 EPDPDDSGFQVD----------AEPDPDDSVLKENIKIGDLMDHDLEDANKFGPDQSDSR 154 EPDPDD + D P+ DDS++ E IK H + N+ PD S S Sbjct: 478 EPDPDDLDAKPDNLGCGSYGNIIRPNHDDSLVSETIKCEA---HPRKVHNEPDPDDSQSN 534 Query: 155 SVEAMKIHAEPDPDDTLTHEIMQVEPDSEDN--HGSPIA--QADEP 280 V I AEPDPDD+ + I+Q EPD +DN H I+ Q DEP Sbjct: 535 GV----IQAEPDPDDSQSIGIIQAEPDPDDNLVHPREISRMQIDEP 576