BLASTX nr result
ID: Cocculus22_contig00002280
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus22_contig00002280 (288 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXC10649.1| Metallothionein-like protein 1 [Morus notabilis] 64 3e-08 dbj|BAF35950.1| metallothionein [Coptis japonica] 58 2e-06 gb|ABN46987.1| metallothionein-like protein 2a [Nelumbo nucifera] 57 3e-06 gb|AAB61212.1| metallothionein [Mesembryanthemum crystallinum] g... 56 4e-06 sp|P43390.1|MT2_ACTDE RecName: Full=Metallothionein-like protein... 56 6e-06 gb|ABL10085.1| metallothionein type 2 [Limonium bicolor] 55 8e-06 >gb|EXC10649.1| Metallothionein-like protein 1 [Morus notabilis] Length = 77 Score = 63.5 bits (153), Expect = 3e-08 Identities = 24/37 (64%), Positives = 29/37 (78%) Frame = -2 Query: 287 APQRAYFEGSEMGVGAENDGCNCGADCKCGSDCMCGK 177 AP + YF+ +EM GAEN GC+CGADC+CGS C CGK Sbjct: 41 APTKTYFQEAEMSYGAENGGCDCGADCQCGSSCACGK 77 >dbj|BAF35950.1| metallothionein [Coptis japonica] Length = 81 Score = 57.8 bits (138), Expect = 2e-06 Identities = 24/35 (68%), Positives = 28/35 (80%) Frame = -2 Query: 287 APQRAYFEGSEMGVGAENDGCNCGADCKCGSDCMC 183 AP++ YFEGSEM VGAENDGC CGA+C C + C C Sbjct: 47 APEKNYFEGSEMSVGAENDGCQCGANCTC-NPCNC 80 >gb|ABN46987.1| metallothionein-like protein 2a [Nelumbo nucifera] Length = 80 Score = 56.6 bits (135), Expect = 3e-06 Identities = 23/35 (65%), Positives = 28/35 (80%) Frame = -2 Query: 287 APQRAYFEGSEMGVGAENDGCNCGADCKCGSDCMC 183 APQ+AYFEGSEM GAEN+GC CG++C C + C C Sbjct: 46 APQKAYFEGSEMSFGAENEGCKCGSNCTC-NPCNC 79 >gb|AAB61212.1| metallothionein [Mesembryanthemum crystallinum] gi|3342198|gb|AAC27531.1| metallothionein [Mesembryanthemum crystallinum] Length = 80 Score = 56.2 bits (134), Expect = 4e-06 Identities = 25/36 (69%), Positives = 29/36 (80%), Gaps = 1/36 (2%) Frame = -2 Query: 287 APQRAYFE-GSEMGVGAENDGCNCGADCKCGSDCMC 183 AP+ +YF+ GSEMGVGAENDGC CG+DCKC C C Sbjct: 45 APKISYFDNGSEMGVGAENDGCKCGSDCKC-DPCTC 79 >sp|P43390.1|MT2_ACTDE RecName: Full=Metallothionein-like protein type 2 gi|1086021|pir||S48038 metallothionein-like protein - kiwi fruit gi|450245|gb|AAA53074.1| metallothionein-like protein [Actinidia deliciosa] Length = 78 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/35 (71%), Positives = 27/35 (77%) Frame = -2 Query: 287 APQRAYFEGSEMGVGAENDGCNCGADCKCGSDCMC 183 APQ+ YFEGSEMGV AEN GC CG+DCKC C C Sbjct: 45 APQKTYFEGSEMGVAAEN-GCKCGSDCKC-DPCTC 77 >gb|ABL10085.1| metallothionein type 2 [Limonium bicolor] Length = 81 Score = 55.5 bits (132), Expect = 8e-06 Identities = 23/35 (65%), Positives = 27/35 (77%) Frame = -2 Query: 287 APQRAYFEGSEMGVGAENDGCNCGADCKCGSDCMC 183 APQR+Y +GSEMGV AENDGC CG +C C + C C Sbjct: 47 APQRSYHDGSEMGVAAENDGCKCGDNCTC-NPCTC 80