BLASTX nr result
ID: Cocculus22_contig00001277
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus22_contig00001277 (312 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_173463.1| hypothetical protein NitaMp125 [Nicotiana tabac... 84 1e-18 >ref|YP_173463.1| hypothetical protein NitaMp125 [Nicotiana tabacum] gi|56806627|dbj|BAD83528.1| hypothetical protein (mitochondrion) [Nicotiana tabacum] Length = 131 Score = 83.6 bits (205), Expect(2) = 1e-18 Identities = 38/41 (92%), Positives = 39/41 (95%) Frame = -2 Query: 179 MGPQRSRWRCQKRDGPGQIEELAVEMGRRFVNRMSHLATPD 57 MGPQRSRWRC KRDGPGQIEELAVE+G RFVNRMSHLATPD Sbjct: 1 MGPQRSRWRCPKRDGPGQIEELAVEIGFRFVNRMSHLATPD 41 Score = 35.0 bits (79), Expect(2) = 1e-18 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = -3 Query: 49 SPGTTAIQRDPKCQGS 2 SPGTTAIQRD KCQGS Sbjct: 43 SPGTTAIQRDSKCQGS 58