BLASTX nr result
ID: Cocculus22_contig00001200
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus22_contig00001200 (392 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002527006.1| catalytic, putative [Ricinus communis] gi|22... 55 8e-06 >ref|XP_002527006.1| catalytic, putative [Ricinus communis] gi|223533641|gb|EEF35378.1| catalytic, putative [Ricinus communis] Length = 526 Score = 55.5 bits (132), Expect = 8e-06 Identities = 24/56 (42%), Positives = 36/56 (64%) Frame = +3 Query: 3 EFPMQTFEATCRLQFLIKWLYVYLKSTLLCKARKLRSVKLLTAISVAGFAMLYAIK 170 EF +Q F TCRL F +W++ YL L +KL KLL A ++AGFA++Y+++ Sbjct: 465 EFSLQKFRRTCRLHFFARWVWAYLTGGFLTGCKKLNKPKLLIAGAMAGFAVVYSVR 520