BLASTX nr result
ID: Cocculus22_contig00001110
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus22_contig00001110 (353 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002516649.1| Protein ABIL2, putative [Ricinus communis] g... 58 1e-06 ref|XP_002317785.1| hypothetical protein POPTR_0012s02400g [Popu... 57 3e-06 >ref|XP_002516649.1| Protein ABIL2, putative [Ricinus communis] gi|223544144|gb|EEF45668.1| Protein ABIL2, putative [Ricinus communis] Length = 312 Score = 58.2 bits (139), Expect = 1e-06 Identities = 28/54 (51%), Positives = 34/54 (62%) Frame = +1 Query: 1 SEPRKSASVRVQGERDNTKDVEQQPXXXXXXXXXXXXXXXXXXDDMLYTFLDEY 162 SEPRKSAS+RVQ E++N+KD+EQ P DDMLYT+LDEY Sbjct: 259 SEPRKSASMRVQAEKENSKDIEQYPSKSKRLLKALLSRRKSKKDDMLYTYLDEY 312 >ref|XP_002317785.1| hypothetical protein POPTR_0012s02400g [Populus trichocarpa] gi|222858458|gb|EEE96005.1| hypothetical protein POPTR_0012s02400g [Populus trichocarpa] Length = 341 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/54 (50%), Positives = 34/54 (62%) Frame = +1 Query: 1 SEPRKSASVRVQGERDNTKDVEQQPXXXXXXXXXXXXXXXXXXDDMLYTFLDEY 162 SEPRKSAS+R+Q E++NTKD+EQ P D+MLYT+LDEY Sbjct: 288 SEPRKSASMRLQAEKENTKDIEQYPSKSKRLLKALLSRRKSKKDEMLYTYLDEY 341