BLASTX nr result
ID: Cocculus22_contig00000948
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus22_contig00000948 (365 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU18271.1| hypothetical protein MIMGU_mgv1a021967mg [Mimulus... 55 8e-06 >gb|EYU18271.1| hypothetical protein MIMGU_mgv1a021967mg [Mimulus guttatus] Length = 285 Score = 55.5 bits (132), Expect = 8e-06 Identities = 32/92 (34%), Positives = 47/92 (51%), Gaps = 4/92 (4%) Frame = +1 Query: 1 MILVYRVSYKLMSSPFSSKYIGPVSRRGETTVVQGNSG----GVSKVVKWDQIQFPETWR 168 +IL+YR+ YK+M++ + P RG TT+ N V K + WDQ+ PE W Sbjct: 86 IILIYRIQYKVMNTVIPRIKVIPTQHRGYTTLFITNLAKSNLKVPKTITWDQVNLPEKWV 145 Query: 169 ALQAEVPSPEVENRNTGRIIRNANGTVTLRFS 264 +A P + ENR II +G V ++FS Sbjct: 146 LEKASEPVKQ-ENRELEEIIEYPDGDVEIQFS 176