BLASTX nr result
ID: Cocculus22_contig00000909
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus22_contig00000909 (390 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB46333.1| hypothetical protein L484_009478 [Morus notabilis] 85 1e-14 ref|XP_006847446.1| hypothetical protein AMTR_s00153p00096120 [A... 84 2e-14 ref|NP_566336.1| uncharacterized protein [Arabidopsis thaliana] ... 83 5e-14 ref|XP_002882587.1| hypothetical protein ARALYDRAFT_897026 [Arab... 82 8e-14 gb|EMT25726.1| hypothetical protein F775_09978 [Aegilops tauschii] 82 1e-13 gb|EMS51749.1| hypothetical protein TRIUR3_08400 [Triticum urartu] 82 1e-13 ref|XP_003569178.1| PREDICTED: uncharacterized protein At5g01610... 82 1e-13 ref|XP_006363618.1| PREDICTED: uncharacterized protein At5g01610... 81 1e-13 ref|XP_004249066.1| PREDICTED: uncharacterized protein At5g01610... 81 1e-13 gb|ADR71307.1| hypothetical protein 29 [Hevea brasiliensis] 81 1e-13 ref|XP_006407736.1| hypothetical protein EUTSA_v10021655mg [Eutr... 81 2e-13 ref|XP_006296628.1| hypothetical protein CARUB_v10014782mg [Caps... 80 2e-13 ref|XP_004170286.1| PREDICTED: uncharacterized protein At5g01610... 80 2e-13 ref|XP_004148607.1| PREDICTED: uncharacterized protein At5g01610... 80 2e-13 ref|XP_003623361.1| hypothetical protein MTR_7g070000 [Medicago ... 80 2e-13 ref|XP_006381248.1| hypothetical protein POPTR_0006s10490g [Popu... 79 5e-13 ref|XP_004492493.1| PREDICTED: uncharacterized protein At5g01610... 79 5e-13 ref|XP_002309157.1| hypothetical protein POPTR_0006s10490g [Popu... 79 5e-13 ref|XP_006654279.1| PREDICTED: uncharacterized protein At5g01610... 79 7e-13 emb|CAD59765.1| cp protein [Celosia cristata] 79 7e-13 >gb|EXB46333.1| hypothetical protein L484_009478 [Morus notabilis] Length = 178 Score = 84.7 bits (208), Expect = 1e-14 Identities = 39/49 (79%), Positives = 46/49 (93%) Frame = -2 Query: 389 GMKTKMMVWVKVTSISTEGSKINFTASMKKARSREAYEVLRDGVSVDKF 243 GMKTK+M+WVKVTSIS++ SK+NFTA MKK+RSR+AYEVLRDGV VDKF Sbjct: 130 GMKTKVMIWVKVTSISSDRSKVNFTAGMKKSRSRDAYEVLRDGVGVDKF 178 >ref|XP_006847446.1| hypothetical protein AMTR_s00153p00096120 [Amborella trichopoda] gi|548850612|gb|ERN09027.1| hypothetical protein AMTR_s00153p00096120 [Amborella trichopoda] Length = 170 Score = 84.3 bits (207), Expect = 2e-14 Identities = 40/49 (81%), Positives = 44/49 (89%) Frame = -2 Query: 389 GMKTKMMVWVKVTSISTEGSKINFTASMKKARSREAYEVLRDGVSVDKF 243 GMKTK+M+WVKVTSISTEGSK+ FT +KKAR REAYEVLRDGV VDKF Sbjct: 122 GMKTKVMIWVKVTSISTEGSKVYFTVGVKKARLREAYEVLRDGVGVDKF 170 >ref|NP_566336.1| uncharacterized protein [Arabidopsis thaliana] gi|30680674|ref|NP_850544.1| uncharacterized protein [Arabidopsis thaliana] gi|6403495|gb|AAF07835.1|AC010871_11 unknown protein [Arabidopsis thaliana] gi|21554089|gb|AAM63170.1| unknown [Arabidopsis thaliana] gi|98960915|gb|ABF58941.1| At3g08890 [Arabidopsis thaliana] gi|110743674|dbj|BAE99674.1| hypothetical protein [Arabidopsis thaliana] gi|332641170|gb|AEE74691.1| uncharacterized protein AT3G08890 [Arabidopsis thaliana] gi|332641171|gb|AEE74692.1| uncharacterized protein AT3G08890 [Arabidopsis thaliana] Length = 170 Score = 82.8 bits (203), Expect = 5e-14 Identities = 37/49 (75%), Positives = 45/49 (91%) Frame = -2 Query: 389 GMKTKMMVWVKVTSISTEGSKINFTASMKKARSREAYEVLRDGVSVDKF 243 GMKTK+M+WVKVTSIS + SK++FTA MKK+RSR+AYEVLRDGV +DKF Sbjct: 122 GMKTKVMIWVKVTSISADSSKVHFTAGMKKSRSRDAYEVLRDGVEIDKF 170 >ref|XP_002882587.1| hypothetical protein ARALYDRAFT_897026 [Arabidopsis lyrata subsp. lyrata] gi|297328427|gb|EFH58846.1| hypothetical protein ARALYDRAFT_897026 [Arabidopsis lyrata subsp. lyrata] Length = 170 Score = 82.0 bits (201), Expect = 8e-14 Identities = 37/49 (75%), Positives = 44/49 (89%) Frame = -2 Query: 389 GMKTKMMVWVKVTSISTEGSKINFTASMKKARSREAYEVLRDGVSVDKF 243 GMKTK+M+WVKVTSIS + SK++FTA MKK RSR+AYEVLRDGV +DKF Sbjct: 122 GMKTKVMIWVKVTSISADSSKVHFTAGMKKIRSRDAYEVLRDGVEIDKF 170 >gb|EMT25726.1| hypothetical protein F775_09978 [Aegilops tauschii] Length = 176 Score = 81.6 bits (200), Expect = 1e-13 Identities = 36/49 (73%), Positives = 44/49 (89%) Frame = -2 Query: 389 GMKTKMMVWVKVTSISTEGSKINFTASMKKARSREAYEVLRDGVSVDKF 243 GMKTK++VW KVTSI TEGSK++FTA MKK RSR+AYEV+RDG+ +DKF Sbjct: 128 GMKTKVLVWTKVTSIKTEGSKVHFTAGMKKTRSRDAYEVVRDGIIIDKF 176 >gb|EMS51749.1| hypothetical protein TRIUR3_08400 [Triticum urartu] Length = 196 Score = 81.6 bits (200), Expect = 1e-13 Identities = 36/49 (73%), Positives = 44/49 (89%) Frame = -2 Query: 389 GMKTKMMVWVKVTSISTEGSKINFTASMKKARSREAYEVLRDGVSVDKF 243 GMKTK++VW KVTSI TEGSK++FTA MKK RSR+AYEV+RDG+ +DKF Sbjct: 148 GMKTKVLVWTKVTSIKTEGSKVHFTAGMKKTRSRDAYEVVRDGIIIDKF 196 >ref|XP_003569178.1| PREDICTED: uncharacterized protein At5g01610-like [Brachypodium distachyon] Length = 170 Score = 81.6 bits (200), Expect = 1e-13 Identities = 36/49 (73%), Positives = 44/49 (89%) Frame = -2 Query: 389 GMKTKMMVWVKVTSISTEGSKINFTASMKKARSREAYEVLRDGVSVDKF 243 GMKTK++VW KVTSI TEGSK++FTA MKK RSR+AYEV+RDG+ +DKF Sbjct: 122 GMKTKVLVWTKVTSIKTEGSKLHFTAGMKKTRSRDAYEVIRDGIVIDKF 170 >ref|XP_006363618.1| PREDICTED: uncharacterized protein At5g01610-like [Solanum tuberosum] Length = 170 Score = 81.3 bits (199), Expect = 1e-13 Identities = 37/49 (75%), Positives = 46/49 (93%) Frame = -2 Query: 389 GMKTKMMVWVKVTSISTEGSKINFTASMKKARSREAYEVLRDGVSVDKF 243 GMKTK+MVWVKVT+IS+E SK++FTA +KK RSREAYEVLRDGV+++KF Sbjct: 122 GMKTKVMVWVKVTAISSEKSKVHFTAGLKKTRSREAYEVLRDGVAIEKF 170 >ref|XP_004249066.1| PREDICTED: uncharacterized protein At5g01610-like [Solanum lycopersicum] Length = 170 Score = 81.3 bits (199), Expect = 1e-13 Identities = 37/49 (75%), Positives = 46/49 (93%) Frame = -2 Query: 389 GMKTKMMVWVKVTSISTEGSKINFTASMKKARSREAYEVLRDGVSVDKF 243 GMKTK+MVWVKVT+IS+E SK++FTA +KK RSREAYEVLRDGV+++KF Sbjct: 122 GMKTKVMVWVKVTAISSEKSKVHFTAGLKKTRSREAYEVLRDGVAIEKF 170 >gb|ADR71307.1| hypothetical protein 29 [Hevea brasiliensis] Length = 170 Score = 81.3 bits (199), Expect = 1e-13 Identities = 37/49 (75%), Positives = 46/49 (93%) Frame = -2 Query: 389 GMKTKMMVWVKVTSISTEGSKINFTASMKKARSREAYEVLRDGVSVDKF 243 G+KTK+MVWVKVT I+++GSK++FTA MKK R+R+AYEVLRDGVSVDKF Sbjct: 122 GIKTKVMVWVKVTCITSDGSKLHFTAGMKKTRNRDAYEVLRDGVSVDKF 170 >ref|XP_006407736.1| hypothetical protein EUTSA_v10021655mg [Eutrema salsugineum] gi|557108882|gb|ESQ49189.1| hypothetical protein EUTSA_v10021655mg [Eutrema salsugineum] Length = 170 Score = 80.9 bits (198), Expect = 2e-13 Identities = 36/49 (73%), Positives = 44/49 (89%) Frame = -2 Query: 389 GMKTKMMVWVKVTSISTEGSKINFTASMKKARSREAYEVLRDGVSVDKF 243 G+KTK+M+WVKVTSIS + SK++FTA MKK RSR+AYEVLRDGV +DKF Sbjct: 122 GVKTKVMIWVKVTSISADSSKVHFTAGMKKTRSRDAYEVLRDGVEIDKF 170 >ref|XP_006296628.1| hypothetical protein CARUB_v10014782mg [Capsella rubella] gi|482565337|gb|EOA29526.1| hypothetical protein CARUB_v10014782mg [Capsella rubella] Length = 170 Score = 80.5 bits (197), Expect = 2e-13 Identities = 36/49 (73%), Positives = 44/49 (89%) Frame = -2 Query: 389 GMKTKMMVWVKVTSISTEGSKINFTASMKKARSREAYEVLRDGVSVDKF 243 GMKTK+M+WVKVTSIS + SK++F A MKK+RSR+AYEVLRDGV +DKF Sbjct: 122 GMKTKVMIWVKVTSISADSSKVHFMAGMKKSRSRDAYEVLRDGVEIDKF 170 >ref|XP_004170286.1| PREDICTED: uncharacterized protein At5g01610-like [Cucumis sativus] Length = 170 Score = 80.5 bits (197), Expect = 2e-13 Identities = 36/49 (73%), Positives = 44/49 (89%) Frame = -2 Query: 389 GMKTKMMVWVKVTSISTEGSKINFTASMKKARSREAYEVLRDGVSVDKF 243 GMKTK+M+WVKVT I+++G K+NFTA MKK R REAYEVLRDGV+V+KF Sbjct: 122 GMKTKVMIWVKVTCITSDGPKLNFTAGMKKTRKREAYEVLRDGVNVEKF 170 >ref|XP_004148607.1| PREDICTED: uncharacterized protein At5g01610-like [Cucumis sativus] Length = 170 Score = 80.5 bits (197), Expect = 2e-13 Identities = 36/49 (73%), Positives = 44/49 (89%) Frame = -2 Query: 389 GMKTKMMVWVKVTSISTEGSKINFTASMKKARSREAYEVLRDGVSVDKF 243 GMKTK+M+WVKVT I+++G K+NFTA MKK R REAYEVLRDGV+V+KF Sbjct: 122 GMKTKVMIWVKVTCITSDGPKLNFTAGMKKTRKREAYEVLRDGVNVEKF 170 >ref|XP_003623361.1| hypothetical protein MTR_7g070000 [Medicago truncatula] gi|355498376|gb|AES79579.1| hypothetical protein MTR_7g070000 [Medicago truncatula] Length = 170 Score = 80.5 bits (197), Expect = 2e-13 Identities = 37/49 (75%), Positives = 43/49 (87%) Frame = -2 Query: 389 GMKTKMMVWVKVTSISTEGSKINFTASMKKARSREAYEVLRDGVSVDKF 243 GMKTK++VWVKVT+IS+EG K+NFTA MKK R REAYEV RDGV +DKF Sbjct: 122 GMKTKVLVWVKVTAISSEGPKLNFTAGMKKTRKREAYEVSRDGVIIDKF 170 >ref|XP_006381248.1| hypothetical protein POPTR_0006s10490g [Populus trichocarpa] gi|550335923|gb|ERP59045.1| hypothetical protein POPTR_0006s10490g [Populus trichocarpa] Length = 152 Score = 79.3 bits (194), Expect = 5e-13 Identities = 36/49 (73%), Positives = 42/49 (85%) Frame = -2 Query: 389 GMKTKMMVWVKVTSISTEGSKINFTASMKKARSREAYEVLRDGVSVDKF 243 GMKTK+M+WVKVT I++ GSK+NFTA MKK R R AYEVLRDGV +DKF Sbjct: 104 GMKTKVMIWVKVTCIASTGSKLNFTAGMKKTRDRGAYEVLRDGVGIDKF 152 >ref|XP_004492493.1| PREDICTED: uncharacterized protein At5g01610-like [Cicer arietinum] Length = 170 Score = 79.3 bits (194), Expect = 5e-13 Identities = 36/49 (73%), Positives = 44/49 (89%) Frame = -2 Query: 389 GMKTKMMVWVKVTSISTEGSKINFTASMKKARSREAYEVLRDGVSVDKF 243 GMKTK++VWVKVT+IS+EGSK++FTA MKK R R+AYEV RDGV +DKF Sbjct: 122 GMKTKVLVWVKVTTISSEGSKLHFTAGMKKTRKRDAYEVSRDGVIIDKF 170 >ref|XP_002309157.1| hypothetical protein POPTR_0006s10490g [Populus trichocarpa] gi|222855133|gb|EEE92680.1| hypothetical protein POPTR_0006s10490g [Populus trichocarpa] Length = 170 Score = 79.3 bits (194), Expect = 5e-13 Identities = 36/49 (73%), Positives = 42/49 (85%) Frame = -2 Query: 389 GMKTKMMVWVKVTSISTEGSKINFTASMKKARSREAYEVLRDGVSVDKF 243 GMKTK+M+WVKVT I++ GSK+NFTA MKK R R AYEVLRDGV +DKF Sbjct: 122 GMKTKVMIWVKVTCIASTGSKLNFTAGMKKTRDRGAYEVLRDGVGIDKF 170 >ref|XP_006654279.1| PREDICTED: uncharacterized protein At5g01610-like [Oryza brachyantha] Length = 170 Score = 79.0 bits (193), Expect = 7e-13 Identities = 33/49 (67%), Positives = 45/49 (91%) Frame = -2 Query: 389 GMKTKMMVWVKVTSISTEGSKINFTASMKKARSREAYEVLRDGVSVDKF 243 G+KTK++VW KVT+I TEGSK++FTA +KK RSR+AYEV+RDG+++DKF Sbjct: 122 GLKTKVLVWTKVTAIKTEGSKVHFTAGVKKTRSRDAYEVVRDGITIDKF 170 >emb|CAD59765.1| cp protein [Celosia cristata] Length = 170 Score = 79.0 bits (193), Expect = 7e-13 Identities = 35/49 (71%), Positives = 46/49 (93%) Frame = -2 Query: 389 GMKTKMMVWVKVTSISTEGSKINFTASMKKARSREAYEVLRDGVSVDKF 243 G+KTK+++WVKVT+I++EGSK++FTA +KK RSREAY+VLRDGV VDKF Sbjct: 122 GLKTKIIIWVKVTAITSEGSKLHFTAGVKKTRSREAYQVLRDGVLVDKF 170