BLASTX nr result
ID: Cocculus22_contig00000880
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus22_contig00000880 (375 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EJK58437.1| hypothetical protein THAOC_21438 [Thalassiosira o... 72 8e-11 ref|XP_007417435.1| hypothetical protein MELLADRAFT_94733 [Melam... 70 2e-10 ref|XP_007413993.1| hypothetical protein MELLADRAFT_90623 [Melam... 70 4e-10 ref|XP_007417431.1| hypothetical protein MELLADRAFT_94729 [Melam... 70 4e-10 gb|EHK48568.1| hypothetical protein TRIATDRAFT_255346 [Trichoder... 69 9e-10 ref|XP_003614391.1| Tar1p [Medicago truncatula] gi|355515726|gb|... 68 1e-09 gb|ENH98510.1| hypothetical protein COCC4DRAFT_155570 [Bipolaris... 68 1e-09 ref|XP_007371709.1| hypothetical protein DICSQDRAFT_73523, parti... 67 3e-09 gb|EGN91453.1| hypothetical protein SERLA73DRAFT_67379 [Serpula ... 67 3e-09 emb|CCW72292.1| unnamed protein product [Phytomonas sp. isolate ... 66 4e-09 emb|CCW65860.1| unnamed protein product [Phytomonas sp. isolate ... 66 4e-09 ref|XP_007335665.1| hypothetical protein AGABI1DRAFT_49393, part... 66 4e-09 gb|EGZ04885.1| hypothetical protein PHYSODRAFT_291676 [Phytophth... 66 4e-09 ref|XP_007413083.1| hypothetical protein MELLADRAFT_90060 [Melam... 66 6e-09 ref|XP_007414633.1| hypothetical protein MELLADRAFT_91703 [Melam... 65 1e-08 ref|XP_007415543.1| hypothetical protein MELLADRAFT_92712 [Melam... 65 1e-08 ref|XP_007405674.1| hypothetical protein MELLADRAFT_92520 [Melam... 65 1e-08 ref|XP_007419024.1| hypothetical protein MELLADRAFT_84532 [Melam... 65 1e-08 gb|EJY66654.1| hypothetical protein OXYTRI_13059 [Oxytricha trif... 64 2e-08 ref|XP_002118246.1| predicted protein [Trichoplax adhaerens] gi|... 61 2e-07 >gb|EJK58437.1| hypothetical protein THAOC_21438 [Thalassiosira oceanica] Length = 104 Score = 72.0 bits (175), Expect = 8e-11 Identities = 36/56 (64%), Positives = 44/56 (78%), Gaps = 1/56 (1%) Frame = +1 Query: 211 LNNTAWNDKIGLYPFY-WLLGKVMINRNSWGHQYLLVRGEILGFIKD*LMRKHLPR 375 LN AWN+KIGL ++ L +VMINR+SWG+ Y +VRGEILGF KD L+RKHLPR Sbjct: 3 LNILAWNNKIGLRNYFVGLRYEVMINRDSWGYSYFVVRGEILGFPKDELLRKHLPR 58 >ref|XP_007417435.1| hypothetical protein MELLADRAFT_94733 [Melampsora larici-populina 98AG31] gi|328850149|gb|EGF99318.1| hypothetical protein MELLADRAFT_94733 [Melampsora larici-populina 98AG31] Length = 106 Score = 70.5 bits (171), Expect = 2e-10 Identities = 29/41 (70%), Positives = 31/41 (75%) Frame = -3 Query: 127 YRQTSRTRRSFNYERFNSNNINICYRSWNYRGCWHQTCPPI 5 +RQTS F+YE FN NN NI Y SWNYRGCWHQTCPPI Sbjct: 31 WRQTSHQTLKFDYELFNVNNFNIRYWSWNYRGCWHQTCPPI 71 >ref|XP_007413993.1| hypothetical protein MELLADRAFT_90623 [Melampsora larici-populina 98AG31] gi|328853743|gb|EGG02880.1| hypothetical protein MELLADRAFT_90623 [Melampsora larici-populina 98AG31] Length = 134 Score = 69.7 bits (169), Expect = 4e-10 Identities = 29/40 (72%), Positives = 30/40 (75%) Frame = -3 Query: 124 RQTSRTRRSFNYERFNSNNINICYRSWNYRGCWHQTCPPI 5 RQTS F+YE FN NN NI Y SWNYRGCWHQTCPPI Sbjct: 60 RQTSHQTLKFDYELFNVNNFNIRYWSWNYRGCWHQTCPPI 99 >ref|XP_007417431.1| hypothetical protein MELLADRAFT_94729 [Melampsora larici-populina 98AG31] gi|328850152|gb|EGF99321.1| hypothetical protein MELLADRAFT_94729 [Melampsora larici-populina 98AG31] Length = 113 Score = 69.7 bits (169), Expect = 4e-10 Identities = 29/40 (72%), Positives = 30/40 (75%) Frame = -3 Query: 124 RQTSRTRRSFNYERFNSNNINICYRSWNYRGCWHQTCPPI 5 RQTS F+YE FN NN NI Y SWNYRGCWHQTCPPI Sbjct: 39 RQTSHQTLKFDYELFNVNNFNIRYWSWNYRGCWHQTCPPI 78 >gb|EHK48568.1| hypothetical protein TRIATDRAFT_255346 [Trichoderma atroviride IMI 206040] Length = 59 Score = 68.6 bits (166), Expect = 9e-10 Identities = 28/40 (70%), Positives = 30/40 (75%) Frame = -3 Query: 124 RQTSRTRRSFNYERFNSNNINICYRSWNYRGCWHQTCPPI 5 R+T + FNYE FN NN NI Y SWNYRGCWHQTCPPI Sbjct: 17 RRTGQPGPRFNYELFNHNNFNIRYWSWNYRGCWHQTCPPI 56 >ref|XP_003614391.1| Tar1p [Medicago truncatula] gi|355515726|gb|AES97349.1| Tar1p [Medicago truncatula] Length = 553 Score = 68.2 bits (165), Expect = 1e-09 Identities = 27/41 (65%), Positives = 31/41 (75%) Frame = -3 Query: 127 YRQTSRTRRSFNYERFNSNNINICYRSWNYRGCWHQTCPPI 5 +R+T R NYE FN NN+NI Y SWNYRGCWHQTCPP+ Sbjct: 510 HRRTDRPNPRSNYELFNCNNLNIRYWSWNYRGCWHQTCPPM 550 >gb|ENH98510.1| hypothetical protein COCC4DRAFT_155570 [Bipolaris maydis ATCC 48331] gi|576911966|gb|EUC26718.1| hypothetical protein COCCADRAFT_42279 [Bipolaris zeicola 26-R-13] Length = 68 Score = 67.8 bits (164), Expect = 1e-09 Identities = 27/32 (84%), Positives = 27/32 (84%) Frame = -3 Query: 100 SFNYERFNSNNINICYRSWNYRGCWHQTCPPI 5 SFNYE FN NN NI Y SWNYRGCWHQTCPPI Sbjct: 34 SFNYELFNCNNFNIRYWSWNYRGCWHQTCPPI 65 >ref|XP_007371709.1| hypothetical protein DICSQDRAFT_73523, partial [Dichomitus squalens LYAD-421 SS1] gi|395323025|gb|EJF55554.1| hypothetical protein DICSQDRAFT_73523, partial [Dichomitus squalens LYAD-421 SS1] Length = 66 Score = 67.0 bits (162), Expect = 3e-09 Identities = 30/46 (65%), Positives = 32/46 (69%), Gaps = 7/46 (15%) Frame = -3 Query: 121 QTSRTRR-------SFNYERFNSNNINICYRSWNYRGCWHQTCPPI 5 Q +RT R +FNYE FN NN NI Y SWNYRGCWHQTCPPI Sbjct: 18 QQNRTARPILLFHANFNYELFNCNNFNIRYWSWNYRGCWHQTCPPI 63 >gb|EGN91453.1| hypothetical protein SERLA73DRAFT_67379 [Serpula lacrymans var. lacrymans S7.3] Length = 80 Score = 66.6 bits (161), Expect = 3e-09 Identities = 26/32 (81%), Positives = 27/32 (84%) Frame = -3 Query: 100 SFNYERFNSNNINICYRSWNYRGCWHQTCPPI 5 +FNYE FN NN NI Y SWNYRGCWHQTCPPI Sbjct: 46 NFNYELFNCNNFNIHYWSWNYRGCWHQTCPPI 77 >emb|CCW72292.1| unnamed protein product [Phytomonas sp. isolate Hart1] Length = 88 Score = 66.2 bits (160), Expect = 4e-09 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -3 Query: 97 FNYERFNSNNINICYRSWNYRGCWHQTCPPI 5 FNYE FNSN+INI + SWNYRGCWHQTCPPI Sbjct: 46 FNYEPFNSNSINIRFWSWNYRGCWHQTCPPI 76 >emb|CCW65860.1| unnamed protein product [Phytomonas sp. isolate EM1] Length = 89 Score = 66.2 bits (160), Expect = 4e-09 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -3 Query: 97 FNYERFNSNNINICYRSWNYRGCWHQTCPPI 5 FNYE FNSN+INI + SWNYRGCWHQTCPPI Sbjct: 47 FNYEPFNSNSINIRFWSWNYRGCWHQTCPPI 77 >ref|XP_007335665.1| hypothetical protein AGABI1DRAFT_49393, partial [Agaricus bisporus var. burnettii JB137-S8] gi|409072524|gb|EKM73697.1| hypothetical protein AGABI1DRAFT_49393, partial [Agaricus bisporus var. burnettii JB137-S8] Length = 73 Score = 66.2 bits (160), Expect = 4e-09 Identities = 29/40 (72%), Positives = 30/40 (75%), Gaps = 1/40 (2%) Frame = -3 Query: 121 QTSRTRR-SFNYERFNSNNINICYRSWNYRGCWHQTCPPI 5 Q +RT R FNY FN NN NI Y SWNYRGCWHQTCPPI Sbjct: 31 QQNRTARLKFNYGLFNCNNFNIRYWSWNYRGCWHQTCPPI 70 >gb|EGZ04885.1| hypothetical protein PHYSODRAFT_291676 [Phytophthora sojae] gi|348671639|gb|EGZ11460.1| hypothetical protein PHYSODRAFT_287468 [Phytophthora sojae] Length = 55 Score = 66.2 bits (160), Expect = 4e-09 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = -3 Query: 121 QTSRTRRSFNYERFNSNNINICYRSWNYRGCWHQTCPPI 5 +T ++ NYE FN NN NI Y SWNYRGCWHQTCPPI Sbjct: 14 RTGHPKQKSNYELFNCNNFNIRYWSWNYRGCWHQTCPPI 52 >ref|XP_007413083.1| hypothetical protein MELLADRAFT_90060 [Melampsora larici-populina 98AG31] gi|328854504|gb|EGG03636.1| hypothetical protein MELLADRAFT_90060 [Melampsora larici-populina 98AG31] Length = 87 Score = 65.9 bits (159), Expect = 6e-09 Identities = 26/39 (66%), Positives = 30/39 (76%) Frame = -3 Query: 121 QTSRTRRSFNYERFNSNNINICYRSWNYRGCWHQTCPPI 5 ++ T+ F+YE FN NN NI Y SWNYRGCWHQTCPPI Sbjct: 14 ESGTTQIDFDYELFNVNNFNIRYWSWNYRGCWHQTCPPI 52 >ref|XP_007414633.1| hypothetical protein MELLADRAFT_91703 [Melampsora larici-populina 98AG31] gi|328852954|gb|EGG02096.1| hypothetical protein MELLADRAFT_91703 [Melampsora larici-populina 98AG31] Length = 71 Score = 65.1 bits (157), Expect = 1e-08 Identities = 25/36 (69%), Positives = 28/36 (77%) Frame = -3 Query: 112 RTRRSFNYERFNSNNINICYRSWNYRGCWHQTCPPI 5 + + F+YE FN NN NI Y SWNYRGCWHQTCPPI Sbjct: 33 KVHQEFDYELFNVNNFNIRYWSWNYRGCWHQTCPPI 68 >ref|XP_007415543.1| hypothetical protein MELLADRAFT_92712 [Melampsora larici-populina 98AG31] gi|328852044|gb|EGG01193.1| hypothetical protein MELLADRAFT_92712 [Melampsora larici-populina 98AG31] Length = 130 Score = 65.1 bits (157), Expect = 1e-08 Identities = 25/36 (69%), Positives = 28/36 (77%) Frame = -3 Query: 112 RTRRSFNYERFNSNNINICYRSWNYRGCWHQTCPPI 5 + + F+YE FN NN NI Y SWNYRGCWHQTCPPI Sbjct: 60 KVHQEFDYELFNVNNFNIRYWSWNYRGCWHQTCPPI 95 >ref|XP_007405674.1| hypothetical protein MELLADRAFT_92520 [Melampsora larici-populina 98AG31] gi|599406978|ref|XP_007413435.1| hypothetical protein MELLADRAFT_90342 [Melampsora larici-populina 98AG31] gi|599420165|ref|XP_007416289.1| hypothetical protein MELLADRAFT_93286 [Melampsora larici-populina 98AG31] gi|599426092|ref|XP_007417784.1| hypothetical protein MELLADRAFT_95029 [Melampsora larici-populina 98AG31] gi|328849783|gb|EGF98957.1| hypothetical protein MELLADRAFT_95029 [Melampsora larici-populina 98AG31] gi|328851287|gb|EGG00443.1| hypothetical protein MELLADRAFT_93286 [Melampsora larici-populina 98AG31] gi|328854166|gb|EGG03300.1| hypothetical protein MELLADRAFT_90342 [Melampsora larici-populina 98AG31] gi|328861970|gb|EGG11072.1| hypothetical protein MELLADRAFT_92520 [Melampsora larici-populina 98AG31] Length = 103 Score = 65.1 bits (157), Expect = 1e-08 Identities = 25/36 (69%), Positives = 28/36 (77%) Frame = -3 Query: 112 RTRRSFNYERFNSNNINICYRSWNYRGCWHQTCPPI 5 + + F+YE FN NN NI Y SWNYRGCWHQTCPPI Sbjct: 33 KVHQEFDYELFNVNNFNIRYWSWNYRGCWHQTCPPI 68 >ref|XP_007419024.1| hypothetical protein MELLADRAFT_84532 [Melampsora larici-populina 98AG31] gi|328848488|gb|EGF97701.1| hypothetical protein MELLADRAFT_84532 [Melampsora larici-populina 98AG31] Length = 146 Score = 65.1 bits (157), Expect = 1e-08 Identities = 25/36 (69%), Positives = 28/36 (77%) Frame = -3 Query: 112 RTRRSFNYERFNSNNINICYRSWNYRGCWHQTCPPI 5 + + F+YE FN NN NI Y SWNYRGCWHQTCPPI Sbjct: 76 KVHQEFDYELFNVNNFNIRYWSWNYRGCWHQTCPPI 111 >gb|EJY66654.1| hypothetical protein OXYTRI_13059 [Oxytricha trifallax] Length = 111 Score = 63.9 bits (154), Expect = 2e-08 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 94 NYERFNSNNINICYRSWNYRGCWHQTCPPI 5 NYE FN NN NI Y SWNYRGCWHQTCPPI Sbjct: 20 NYELFNCNNFNIRYWSWNYRGCWHQTCPPI 49 >ref|XP_002118246.1| predicted protein [Trichoplax adhaerens] gi|190579147|gb|EDV19249.1| predicted protein [Trichoplax adhaerens] Length = 183 Score = 60.8 bits (146), Expect = 2e-07 Identities = 26/35 (74%), Positives = 31/35 (88%) Frame = +1 Query: 271 KVMINRNSWGHQYLLVRGEILGFIKD*LMRKHLPR 375 +VMINR+SWGH Y +VRGEILGF+KD +RKHLPR Sbjct: 74 EVMINRDSWGHSYFIVRGEILGFMKDEQLRKHLPR 108