BLASTX nr result
ID: Cocculus22_contig00000450
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus22_contig00000450 (824 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002534948.1| conserved hypothetical protein [Ricinus comm... 80 1e-12 emb|CBI36501.3| unnamed protein product [Vitis vinifera] 78 5e-12 >ref|XP_002534948.1| conserved hypothetical protein [Ricinus communis] gi|223524314|gb|EEF27433.1| conserved hypothetical protein [Ricinus communis] Length = 114 Score = 79.7 bits (195), Expect = 1e-12 Identities = 37/39 (94%), Positives = 38/39 (97%) Frame = -2 Query: 334 SQLLAFSLPRGEGSLTYGFQAWREAKGLDFTYDQISGQP 218 S LLAFSLPRGEGSLTYGFQAWR+AKGLDFTYDQISGQP Sbjct: 76 SLLLAFSLPRGEGSLTYGFQAWRKAKGLDFTYDQISGQP 114 >emb|CBI36501.3| unnamed protein product [Vitis vinifera] Length = 274 Score = 77.8 bits (190), Expect = 5e-12 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = -2 Query: 328 LLAFSLPRGEGSLTYGFQAWREAKGLDFTYDQISGQP 218 LLAFSLP+GEGSLTYGFQAWRE KGLDFTYDQISGQP Sbjct: 238 LLAFSLPKGEGSLTYGFQAWREVKGLDFTYDQISGQP 274