BLASTX nr result
ID: Cocculus22_contig00000431
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus22_contig00000431 (355 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pdb|1TI3|A Chain A, Solution Structure Of The Thioredoxin H1 Fro... 67 2e-09 ref|XP_002307687.1| thioredoxin h family protein [Populus tricho... 67 2e-09 ref|XP_004238306.1| PREDICTED: thioredoxin H-type 1-like [Solanu... 65 8e-09 ref|XP_003527904.1| PREDICTED: thioredoxin H-type [Glycine max] 65 1e-08 ref|XP_004500971.1| PREDICTED: thioredoxin H-type-like [Cicer ar... 64 2e-08 gb|ABD65296.1| thioredoxin [Solanum berthaultii] 64 2e-08 ref|XP_006341987.1| PREDICTED: thioredoxin H-type 1-like [Solanu... 64 3e-08 ref|XP_006386198.1| hypothetical protein POPTR_0002s03140g [Popu... 62 6e-08 sp|P29449.1|TRXH1_TOBAC RecName: Full=Thioredoxin H-type 1; Shor... 62 6e-08 gb|AFK40280.1| unknown [Medicago truncatula] 62 6e-08 ref|XP_002300738.1| thioredoxin h family protein [Populus tricho... 62 6e-08 gb|ABK93640.1| unknown [Populus trichocarpa] 62 6e-08 ref|XP_003589341.1| Thioredoxin H-type [Medicago truncatula] gi|... 62 6e-08 ref|XP_004499205.1| PREDICTED: thioredoxin H-type 1-like [Cicer ... 62 8e-08 ref|XP_007202766.1| hypothetical protein PRUPE_ppa013476mg [Prun... 61 1e-07 gb|ADU56183.1| thioredoxin H-type [Jatropha curcas] 61 2e-07 gb|ACV52592.1| thioredoxin H-type 1, partial [Nicotiana benthami... 61 2e-07 gb|EXC25027.1| Thioredoxin H-type 1 [Morus notabilis] 60 2e-07 ref|XP_004287851.1| PREDICTED: thioredoxin H-type-like [Fragaria... 60 2e-07 ref|XP_007223789.1| hypothetical protein PRUPE_ppa013161mg [Prun... 60 2e-07 >pdb|1TI3|A Chain A, Solution Structure Of The Thioredoxin H1 From Poplar, A Cppc Active Site Variant Length = 113 Score = 67.4 bits (163), Expect = 2e-09 Identities = 31/41 (75%), Positives = 34/41 (82%) Frame = +1 Query: 1 KEWNVEAMPTFIFIKEGKLVDKIVGADKAGLENTVVKHAAA 123 +EWNVEAMPTFIF+K+GKLVDK VGADK GL V KHA A Sbjct: 73 EEWNVEAMPTFIFLKDGKLVDKTVGADKDGLPTLVAKHATA 113 >ref|XP_002307687.1| thioredoxin h family protein [Populus trichocarpa] gi|19851972|gb|AAL99941.1| thioredoxin H [Populus tremula x Populus tremuloides] gi|118485155|gb|ABK94440.1| unknown [Populus trichocarpa] gi|222857136|gb|EEE94683.1| thioredoxin h family protein [Populus trichocarpa] Length = 114 Score = 67.4 bits (163), Expect = 2e-09 Identities = 31/41 (75%), Positives = 34/41 (82%) Frame = +1 Query: 1 KEWNVEAMPTFIFIKEGKLVDKIVGADKAGLENTVVKHAAA 123 +EWNVEAMPTFIF+K+GKLVDK VGADK GL V KHA A Sbjct: 74 EEWNVEAMPTFIFLKDGKLVDKTVGADKDGLPTLVAKHATA 114 >ref|XP_004238306.1| PREDICTED: thioredoxin H-type 1-like [Solanum lycopersicum] Length = 123 Score = 65.5 bits (158), Expect = 8e-09 Identities = 30/45 (66%), Positives = 37/45 (82%) Frame = +1 Query: 1 KEWNVEAMPTFIFIKEGKLVDKIVGADKAGLENTVVKHAAA*CVL 135 +EWNVEAMPTF+FIKEGK VD++VGA+K GL T+ KH AA V+ Sbjct: 77 EEWNVEAMPTFVFIKEGKEVDRVVGANKDGLLQTIEKHGAAPAVV 121 >ref|XP_003527904.1| PREDICTED: thioredoxin H-type [Glycine max] Length = 117 Score = 64.7 bits (156), Expect = 1e-08 Identities = 28/40 (70%), Positives = 34/40 (85%) Frame = +1 Query: 1 KEWNVEAMPTFIFIKEGKLVDKIVGADKAGLENTVVKHAA 120 KEW +EAMPTF+F+KEGKLVDK+VGA K L+ T+ KHAA Sbjct: 74 KEWGIEAMPTFLFLKEGKLVDKVVGAKKEELQLTIAKHAA 113 >ref|XP_004500971.1| PREDICTED: thioredoxin H-type-like [Cicer arietinum] Length = 113 Score = 63.9 bits (154), Expect = 2e-08 Identities = 27/39 (69%), Positives = 34/39 (87%) Frame = +1 Query: 1 KEWNVEAMPTFIFIKEGKLVDKIVGADKAGLENTVVKHA 117 +EW VEAMPTF+F+KEGKLVDK+VGA K L++T+ KHA Sbjct: 75 EEWGVEAMPTFLFLKEGKLVDKVVGAQKEKLQSTIAKHA 113 >gb|ABD65296.1| thioredoxin [Solanum berthaultii] Length = 123 Score = 63.9 bits (154), Expect = 2e-08 Identities = 28/41 (68%), Positives = 35/41 (85%) Frame = +1 Query: 1 KEWNVEAMPTFIFIKEGKLVDKIVGADKAGLENTVVKHAAA 123 ++WNVEAMPTF+FIKEGK VD++VGA+K GL T+ KH AA Sbjct: 77 EDWNVEAMPTFVFIKEGKEVDRVVGANKDGLLQTIEKHGAA 117 >ref|XP_006341987.1| PREDICTED: thioredoxin H-type 1-like [Solanum tuberosum] Length = 123 Score = 63.5 bits (153), Expect = 3e-08 Identities = 28/41 (68%), Positives = 34/41 (82%) Frame = +1 Query: 1 KEWNVEAMPTFIFIKEGKLVDKIVGADKAGLENTVVKHAAA 123 ++WNVEAMPTF+FIKEGK VD++VGA K GL T+ KH AA Sbjct: 77 EDWNVEAMPTFVFIKEGKEVDRVVGAHKEGLLQTIEKHGAA 117 >ref|XP_006386198.1| hypothetical protein POPTR_0002s03140g [Populus trichocarpa] gi|550344173|gb|ERP63995.1| hypothetical protein POPTR_0002s03140g [Populus trichocarpa] Length = 112 Score = 62.4 bits (150), Expect = 6e-08 Identities = 29/38 (76%), Positives = 32/38 (84%) Frame = +1 Query: 4 EWNVEAMPTFIFIKEGKLVDKIVGADKAGLENTVVKHA 117 EW VEAMPTFIF+K+GKLVDKIVGADK GL V KH+ Sbjct: 71 EWEVEAMPTFIFLKDGKLVDKIVGADKDGLPALVEKHS 108 >sp|P29449.1|TRXH1_TOBAC RecName: Full=Thioredoxin H-type 1; Short=Trx-H1 gi|20047|emb|CAA41415.1| thioredoxin [Nicotiana tabacum] Length = 126 Score = 62.4 bits (150), Expect = 6e-08 Identities = 27/39 (69%), Positives = 34/39 (87%) Frame = +1 Query: 4 EWNVEAMPTFIFIKEGKLVDKIVGADKAGLENTVVKHAA 120 EW+VEAMPTF+FIK+GK VD++VGA K L+ T+VKHAA Sbjct: 82 EWSVEAMPTFVFIKDGKEVDRVVGAKKEELQQTIVKHAA 120 >gb|AFK40280.1| unknown [Medicago truncatula] Length = 96 Score = 62.4 bits (150), Expect = 6e-08 Identities = 28/41 (68%), Positives = 33/41 (80%) Frame = +1 Query: 1 KEWNVEAMPTFIFIKEGKLVDKIVGADKAGLENTVVKHAAA 123 KEW+VEAMPTF+F+KEGK VDK+VGA K LEN + KH A Sbjct: 51 KEWSVEAMPTFLFLKEGKEVDKVVGARKEELENAITKHKDA 91 >ref|XP_002300738.1| thioredoxin h family protein [Populus trichocarpa] gi|222842464|gb|EEE80011.1| thioredoxin h family protein [Populus trichocarpa] Length = 116 Score = 62.4 bits (150), Expect = 6e-08 Identities = 29/38 (76%), Positives = 32/38 (84%) Frame = +1 Query: 4 EWNVEAMPTFIFIKEGKLVDKIVGADKAGLENTVVKHA 117 EW VEAMPTFIF+K+GKLVDKIVGADK GL V KH+ Sbjct: 75 EWEVEAMPTFIFLKDGKLVDKIVGADKDGLPALVEKHS 112 >gb|ABK93640.1| unknown [Populus trichocarpa] Length = 116 Score = 62.4 bits (150), Expect = 6e-08 Identities = 29/38 (76%), Positives = 32/38 (84%) Frame = +1 Query: 4 EWNVEAMPTFIFIKEGKLVDKIVGADKAGLENTVVKHA 117 EW VEAMPTFIF+K+GKLVDKIVGADK GL V KH+ Sbjct: 75 EWEVEAMPTFIFLKDGKLVDKIVGADKDGLPALVEKHS 112 >ref|XP_003589341.1| Thioredoxin H-type [Medicago truncatula] gi|74058514|gb|AAZ98843.1| thioredoxin h2 [Medicago truncatula] gi|355478389|gb|AES59592.1| Thioredoxin H-type [Medicago truncatula] Length = 120 Score = 62.4 bits (150), Expect = 6e-08 Identities = 28/41 (68%), Positives = 33/41 (80%) Frame = +1 Query: 1 KEWNVEAMPTFIFIKEGKLVDKIVGADKAGLENTVVKHAAA 123 KEW+VEAMPTF+F+KEGK VDK+VGA K LEN + KH A Sbjct: 75 KEWSVEAMPTFLFLKEGKEVDKVVGARKEELENAITKHKDA 115 >ref|XP_004499205.1| PREDICTED: thioredoxin H-type 1-like [Cicer arietinum] Length = 120 Score = 62.0 bits (149), Expect = 8e-08 Identities = 27/41 (65%), Positives = 34/41 (82%) Frame = +1 Query: 1 KEWNVEAMPTFIFIKEGKLVDKIVGADKAGLENTVVKHAAA 123 +EW+VEAMPTF+F+KEGK VDK+VGA K L+ T+ KHA A Sbjct: 75 EEWSVEAMPTFLFLKEGKKVDKVVGAKKELLQQTITKHATA 115 >ref|XP_007202766.1| hypothetical protein PRUPE_ppa013476mg [Prunus persica] gi|462398297|gb|EMJ03965.1| hypothetical protein PRUPE_ppa013476mg [Prunus persica] Length = 120 Score = 61.2 bits (147), Expect = 1e-07 Identities = 26/41 (63%), Positives = 34/41 (82%) Frame = +1 Query: 1 KEWNVEAMPTFIFIKEGKLVDKIVGADKAGLENTVVKHAAA 123 ++W VEAMPTF+F+KEGK+VDK+VGA K L+ T+ KH AA Sbjct: 75 QDWAVEAMPTFMFLKEGKIVDKVVGAKKDELQQTIAKHVAA 115 >gb|ADU56183.1| thioredoxin H-type [Jatropha curcas] Length = 118 Score = 60.8 bits (146), Expect = 2e-07 Identities = 26/39 (66%), Positives = 34/39 (87%) Frame = +1 Query: 1 KEWNVEAMPTFIFIKEGKLVDKIVGADKAGLENTVVKHA 117 ++W VEAMPTF+F+KEGK+VDK+VGA K L+ T+VKHA Sbjct: 74 EDWAVEAMPTFMFLKEGKIVDKVVGAKKEELQMTIVKHA 112 >gb|ACV52592.1| thioredoxin H-type 1, partial [Nicotiana benthamiana] Length = 119 Score = 60.8 bits (146), Expect = 2e-07 Identities = 25/40 (62%), Positives = 35/40 (87%) Frame = +1 Query: 1 KEWNVEAMPTFIFIKEGKLVDKIVGADKAGLENTVVKHAA 120 +EW+VEAMPTF+F+K+GK VD++VGA K L+ T++KHAA Sbjct: 74 EEWSVEAMPTFVFLKDGKEVDRVVGAKKEELQQTILKHAA 113 >gb|EXC25027.1| Thioredoxin H-type 1 [Morus notabilis] Length = 174 Score = 60.5 bits (145), Expect = 2e-07 Identities = 28/40 (70%), Positives = 33/40 (82%) Frame = +1 Query: 4 EWNVEAMPTFIFIKEGKLVDKIVGADKAGLENTVVKHAAA 123 EW VEAMPTF+F+KEGK+VDK+VGA K L VVKH+AA Sbjct: 134 EWEVEAMPTFLFLKEGKVVDKLVGARKEELLEKVVKHSAA 173 >ref|XP_004287851.1| PREDICTED: thioredoxin H-type-like [Fragaria vesca subsp. vesca] Length = 118 Score = 60.5 bits (145), Expect = 2e-07 Identities = 26/40 (65%), Positives = 33/40 (82%) Frame = +1 Query: 1 KEWNVEAMPTFIFIKEGKLVDKIVGADKAGLENTVVKHAA 120 ++W VEAMPTF+F+KEGK+VDK+VGA K L+ TV KH A Sbjct: 75 EDWAVEAMPTFMFLKEGKIVDKVVGAKKEELQQTVAKHVA 114 >ref|XP_007223789.1| hypothetical protein PRUPE_ppa013161mg [Prunus persica] gi|16588843|gb|AAL26915.1|AF323593_1 thioredoxin H [Prunus persica] gi|462420725|gb|EMJ24988.1| hypothetical protein PRUPE_ppa013161mg [Prunus persica] Length = 136 Score = 60.5 bits (145), Expect = 2e-07 Identities = 27/41 (65%), Positives = 33/41 (80%) Frame = +1 Query: 1 KEWNVEAMPTFIFIKEGKLVDKIVGADKAGLENTVVKHAAA 123 +EW VEAMPTF+F+KEGK+VDK+VGA K L+ V KH AA Sbjct: 74 EEWGVEAMPTFLFLKEGKIVDKVVGAKKDELQIKVAKHVAA 114