BLASTX nr result
ID: Cocculus22_contig00000287
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus22_contig00000287 (632 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI24963.3| unnamed protein product [Vitis vinifera] 75 1e-11 ref|XP_002274498.1| PREDICTED: 50S ribosomal protein L1, chlorop... 75 1e-11 ref|XP_004149726.1| PREDICTED: 50S ribosomal protein L1, chlorop... 75 2e-11 gb|EPS69025.1| ribosomal protein, partial [Genlisea aurea] 74 5e-11 gb|EEC79148.1| hypothetical protein OsI_19812 [Oryza sativa Indi... 73 6e-11 ref|NP_001055429.1| Os05g0388500 [Oryza sativa Japonica Group] g... 73 6e-11 ref|XP_002517771.1| 50S ribosomal protein L1p, putative [Ricinus... 72 1e-10 ref|XP_006837434.1| hypothetical protein AMTR_s00107p00035950 [A... 72 1e-10 ref|XP_007052473.1| Ribosomal protein L1p/L10e family [Theobroma... 70 4e-10 ref|XP_004962205.1| PREDICTED: 50S ribosomal protein L1, chlorop... 70 5e-10 gb|AFW77855.1| ribosomal protein [Zea mays] 70 5e-10 ref|XP_002439732.1| hypothetical protein SORBIDRAFT_09g019170 [S... 70 5e-10 ref|NP_001150277.1| 50S ribosomal protein L1 [Zea mays] gi|19563... 70 5e-10 ref|XP_006482926.1| PREDICTED: 50S ribosomal protein L1, chlorop... 70 7e-10 ref|XP_006438956.1| hypothetical protein CICLE_v10031877mg [Citr... 70 7e-10 ref|XP_004158181.1| PREDICTED: 50S ribosomal protein L1, chlorop... 69 2e-09 ref|XP_004135947.1| PREDICTED: 50S ribosomal protein L1, chlorop... 69 2e-09 ref|XP_006345407.1| PREDICTED: 50S ribosomal protein L1, chlorop... 68 3e-09 ref|XP_004229660.1| PREDICTED: 50S ribosomal protein L1, chlorop... 67 4e-09 dbj|BAJ85161.1| predicted protein [Hordeum vulgare subsp. vulgare] 67 4e-09 >emb|CBI24963.3| unnamed protein product [Vitis vinifera] Length = 343 Score = 75.5 bits (184), Expect = 1e-11 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +2 Query: 506 RDRRRSKRFLEIQKLRENKKEHDLPTAISLLKQMASTKFVET 631 RDR RSKRFLEIQKLRENKKE+DL TAISLLKQMAST+FVET Sbjct: 105 RDRTRSKRFLEIQKLRENKKEYDLQTAISLLKQMASTRFVET 146 >ref|XP_002274498.1| PREDICTED: 50S ribosomal protein L1, chloroplastic [Vitis vinifera] Length = 347 Score = 75.5 bits (184), Expect = 1e-11 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +2 Query: 506 RDRRRSKRFLEIQKLRENKKEHDLPTAISLLKQMASTKFVET 631 RDR RSKRFLEIQKLRENKKE+DL TAISLLKQMAST+FVET Sbjct: 109 RDRTRSKRFLEIQKLRENKKEYDLQTAISLLKQMASTRFVET 150 >ref|XP_004149726.1| PREDICTED: 50S ribosomal protein L1, chloroplastic-like [Cucumis sativus] gi|449532743|ref|XP_004173340.1| PREDICTED: 50S ribosomal protein L1, chloroplastic-like [Cucumis sativus] Length = 356 Score = 74.7 bits (182), Expect = 2e-11 Identities = 36/42 (85%), Positives = 41/42 (97%) Frame = +2 Query: 506 RDRRRSKRFLEIQKLRENKKEHDLPTAISLLKQMASTKFVET 631 RDRRRSKRFLEIQKLRENKKE+DL TAISLLK+M+STKF+E+ Sbjct: 118 RDRRRSKRFLEIQKLRENKKEYDLTTAISLLKEMSSTKFIES 159 >gb|EPS69025.1| ribosomal protein, partial [Genlisea aurea] Length = 303 Score = 73.6 bits (179), Expect = 5e-11 Identities = 37/42 (88%), Positives = 39/42 (92%) Frame = +2 Query: 506 RDRRRSKRFLEIQKLRENKKEHDLPTAISLLKQMASTKFVET 631 RDR RSKRFLEIQKLRENK+EHDL TAISLLKQ ASTKFVE+ Sbjct: 68 RDRTRSKRFLEIQKLRENKQEHDLKTAISLLKQTASTKFVES 109 >gb|EEC79148.1| hypothetical protein OsI_19812 [Oryza sativa Indica Group] Length = 414 Score = 73.2 bits (178), Expect = 6e-11 Identities = 35/42 (83%), Positives = 40/42 (95%) Frame = +2 Query: 506 RDRRRSKRFLEIQKLRENKKEHDLPTAISLLKQMASTKFVET 631 RDR RSKRFLEIQKLRE+KKEHD+PTAISL+KQMAS +FVE+ Sbjct: 176 RDRTRSKRFLEIQKLRESKKEHDVPTAISLVKQMASARFVES 217 >ref|NP_001055429.1| Os05g0388500 [Oryza sativa Japonica Group] gi|54287599|gb|AAV31343.1| putative chloroplast ribosomal protein L1 [Oryza sativa Japonica Group] gi|113578980|dbj|BAF17343.1| Os05g0388500 [Oryza sativa Japonica Group] gi|215694446|dbj|BAG89463.1| unnamed protein product [Oryza sativa Japonica Group] gi|215704417|dbj|BAG93851.1| unnamed protein product [Oryza sativa Japonica Group] gi|222631453|gb|EEE63585.1| hypothetical protein OsJ_18402 [Oryza sativa Japonica Group] Length = 359 Score = 73.2 bits (178), Expect = 6e-11 Identities = 35/42 (83%), Positives = 40/42 (95%) Frame = +2 Query: 506 RDRRRSKRFLEIQKLRENKKEHDLPTAISLLKQMASTKFVET 631 RDR RSKRFLEIQKLRE+KKEHD+PTAISL+KQMAS +FVE+ Sbjct: 121 RDRTRSKRFLEIQKLRESKKEHDVPTAISLVKQMASARFVES 162 >ref|XP_002517771.1| 50S ribosomal protein L1p, putative [Ricinus communis] gi|223543043|gb|EEF44578.1| 50S ribosomal protein L1p, putative [Ricinus communis] Length = 360 Score = 72.4 bits (176), Expect = 1e-10 Identities = 36/42 (85%), Positives = 40/42 (95%) Frame = +2 Query: 506 RDRRRSKRFLEIQKLRENKKEHDLPTAISLLKQMASTKFVET 631 RDR RSKRFLEIQKLRENK+E+DL TAISLLKQMA++KFVET Sbjct: 122 RDRARSKRFLEIQKLRENKQEYDLQTAISLLKQMATSKFVET 163 >ref|XP_006837434.1| hypothetical protein AMTR_s00107p00035950 [Amborella trichopoda] gi|548840075|gb|ERN00288.1| hypothetical protein AMTR_s00107p00035950 [Amborella trichopoda] Length = 361 Score = 72.0 bits (175), Expect = 1e-10 Identities = 36/42 (85%), Positives = 40/42 (95%) Frame = +2 Query: 506 RDRRRSKRFLEIQKLRENKKEHDLPTAISLLKQMASTKFVET 631 RDRRRSKRFLEIQKLRENK+E+DL TAISLLK+ A+TKFVET Sbjct: 123 RDRRRSKRFLEIQKLRENKQEYDLRTAISLLKKTANTKFVET 164 >ref|XP_007052473.1| Ribosomal protein L1p/L10e family [Theobroma cacao] gi|508704734|gb|EOX96630.1| Ribosomal protein L1p/L10e family [Theobroma cacao] Length = 356 Score = 70.5 bits (171), Expect = 4e-10 Identities = 35/42 (83%), Positives = 38/42 (90%) Frame = +2 Query: 506 RDRRRSKRFLEIQKLRENKKEHDLPTAISLLKQMASTKFVET 631 RDR RSKRFLEIQKLRENKKE+DL TAISLLK+M S KFVE+ Sbjct: 118 RDRTRSKRFLEIQKLRENKKEYDLKTAISLLKEMTSAKFVES 159 >ref|XP_004962205.1| PREDICTED: 50S ribosomal protein L1, chloroplastic-like [Setaria italica] Length = 344 Score = 70.1 bits (170), Expect = 5e-10 Identities = 34/42 (80%), Positives = 39/42 (92%) Frame = +2 Query: 506 RDRRRSKRFLEIQKLRENKKEHDLPTAISLLKQMASTKFVET 631 RDR RSKRFLEIQKLRE+KKE+D+PTAISL+KQMAS KF E+ Sbjct: 106 RDRTRSKRFLEIQKLRESKKEYDVPTAISLMKQMASAKFKES 147 >gb|AFW77855.1| ribosomal protein [Zea mays] Length = 345 Score = 70.1 bits (170), Expect = 5e-10 Identities = 33/42 (78%), Positives = 40/42 (95%) Frame = +2 Query: 506 RDRRRSKRFLEIQKLRENKKEHDLPTAISLLKQMASTKFVET 631 RDR RSKRFLEIQKLRE+KK++D+PTAISL+KQM+S KFVE+ Sbjct: 107 RDRTRSKRFLEIQKLRESKKDYDVPTAISLMKQMSSAKFVES 148 >ref|XP_002439732.1| hypothetical protein SORBIDRAFT_09g019170 [Sorghum bicolor] gi|241945017|gb|EES18162.1| hypothetical protein SORBIDRAFT_09g019170 [Sorghum bicolor] Length = 346 Score = 70.1 bits (170), Expect = 5e-10 Identities = 33/42 (78%), Positives = 40/42 (95%) Frame = +2 Query: 506 RDRRRSKRFLEIQKLRENKKEHDLPTAISLLKQMASTKFVET 631 RDR RSKRFLEIQKLRE+KK++D+PTAISL+KQM+S KFVE+ Sbjct: 108 RDRTRSKRFLEIQKLRESKKDYDVPTAISLMKQMSSAKFVES 149 >ref|NP_001150277.1| 50S ribosomal protein L1 [Zea mays] gi|195638036|gb|ACG38486.1| 50S ribosomal protein L1 [Zea mays] Length = 345 Score = 70.1 bits (170), Expect = 5e-10 Identities = 33/42 (78%), Positives = 40/42 (95%) Frame = +2 Query: 506 RDRRRSKRFLEIQKLRENKKEHDLPTAISLLKQMASTKFVET 631 RDR RSKRFLEIQKLRE+KK++D+PTAISL+KQM+S KFVE+ Sbjct: 107 RDRTRSKRFLEIQKLRESKKDYDVPTAISLMKQMSSAKFVES 148 >ref|XP_006482926.1| PREDICTED: 50S ribosomal protein L1, chloroplastic-like [Citrus sinensis] Length = 369 Score = 69.7 bits (169), Expect = 7e-10 Identities = 35/42 (83%), Positives = 37/42 (88%) Frame = +2 Query: 506 RDRRRSKRFLEIQKLRENKKEHDLPTAISLLKQMASTKFVET 631 RDR RSKRFLEIQ LRE KKE+DL TAISLLKQM+STKF ET Sbjct: 131 RDRTRSKRFLEIQNLREGKKEYDLKTAISLLKQMSSTKFTET 172 >ref|XP_006438956.1| hypothetical protein CICLE_v10031877mg [Citrus clementina] gi|557541152|gb|ESR52196.1| hypothetical protein CICLE_v10031877mg [Citrus clementina] Length = 369 Score = 69.7 bits (169), Expect = 7e-10 Identities = 35/42 (83%), Positives = 37/42 (88%) Frame = +2 Query: 506 RDRRRSKRFLEIQKLRENKKEHDLPTAISLLKQMASTKFVET 631 RDR RSKRFLEIQ LRE KKE+DL TAISLLKQM+STKF ET Sbjct: 131 RDRTRSKRFLEIQNLREGKKEYDLKTAISLLKQMSSTKFTET 172 >ref|XP_004158181.1| PREDICTED: 50S ribosomal protein L1, chloroplastic-like [Cucumis sativus] Length = 360 Score = 68.6 bits (166), Expect = 2e-09 Identities = 35/42 (83%), Positives = 37/42 (88%) Frame = +2 Query: 506 RDRRRSKRFLEIQKLRENKKEHDLPTAISLLKQMASTKFVET 631 RDR RSKRFLEIQKLRE K E+DL TAISLLKQ +STKFVET Sbjct: 121 RDRTRSKRFLEIQKLRETKMEYDLKTAISLLKQTSSTKFVET 162 >ref|XP_004135947.1| PREDICTED: 50S ribosomal protein L1, chloroplastic-like [Cucumis sativus] Length = 360 Score = 68.6 bits (166), Expect = 2e-09 Identities = 35/42 (83%), Positives = 37/42 (88%) Frame = +2 Query: 506 RDRRRSKRFLEIQKLRENKKEHDLPTAISLLKQMASTKFVET 631 RDR RSKRFLEIQKLRE K E+DL TAISLLKQ +STKFVET Sbjct: 121 RDRTRSKRFLEIQKLRETKMEYDLKTAISLLKQTSSTKFVET 162 >ref|XP_006345407.1| PREDICTED: 50S ribosomal protein L1, chloroplastic-like [Solanum tuberosum] Length = 341 Score = 67.8 bits (164), Expect = 3e-09 Identities = 35/42 (83%), Positives = 37/42 (88%) Frame = +2 Query: 506 RDRRRSKRFLEIQKLRENKKEHDLPTAISLLKQMASTKFVET 631 RDR RSKRFLEIQKLRE KKE+DL TAI LLKQ AS+KFVET Sbjct: 104 RDRTRSKRFLEIQKLREIKKEYDLKTAIELLKQTASSKFVET 145 >ref|XP_004229660.1| PREDICTED: 50S ribosomal protein L1, chloroplastic-like [Solanum lycopersicum] Length = 338 Score = 67.0 bits (162), Expect = 4e-09 Identities = 35/42 (83%), Positives = 36/42 (85%) Frame = +2 Query: 506 RDRRRSKRFLEIQKLRENKKEHDLPTAISLLKQMASTKFVET 631 RDR RSKRFLEIQKLRE KKE+DL TAI LLKQ AS KFVET Sbjct: 101 RDRTRSKRFLEIQKLREIKKEYDLKTAIELLKQTASLKFVET 142 >dbj|BAJ85161.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 347 Score = 67.0 bits (162), Expect = 4e-09 Identities = 31/42 (73%), Positives = 40/42 (95%) Frame = +2 Query: 506 RDRRRSKRFLEIQKLRENKKEHDLPTAISLLKQMASTKFVET 631 RDR RSKR+LEIQKLRE+KKE+D+P AISL+KQ+A+T+FVE+ Sbjct: 109 RDRTRSKRYLEIQKLRESKKEYDVPMAISLMKQVANTRFVES 150