BLASTX nr result
ID: Cocculus22_contig00000220
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cocculus22_contig00000220 (409 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value sp|P16346.1|IBBWT_MEDSA RecName: Full=Bowman-Birk type wound-ind... 76 6e-12 sp|P85172.1|IBB1_LUPAL RecName: Full=Bowman-Birk type proteinase... 75 7e-12 emb|CAA56254.1| serine proteinase inhibitor [Medicago sativa] 75 7e-12 emb|CAA56253.1| serine proteinase inhibitor [Medicago sativa] 75 7e-12 emb|CAC24564.1| trypsin inhibitor [Pisum sativum] 74 2e-11 gb|ACJ86027.1| unknown [Medicago truncatula] gi|388496776|gb|AFK... 72 6e-11 ref|XP_003623932.1| Trypsin inhibitor [Medicago truncatula] gi|3... 72 6e-11 emb|CAH04454.1| putative trypsin inhibitor [Lens nigricans] 72 6e-11 pdb|1PBI|A Chain A, Crystal Structure Of A Bowman-Birk Inhibitor... 72 8e-11 sp|P80321.2|IBB_MEDSC RecName: Full=Bowman-Birk type proteinase ... 72 8e-11 gb|AFK40073.1| unknown [Lotus japonicus] 72 8e-11 ref|XP_003623935.1| Bowman-Birk type proteinase inhibitor [Medic... 72 8e-11 emb|CAH04453.1| putative trypsin inhibitor [Lens ervoides] 72 8e-11 gb|AAQ10729.1| trypsin inhibitor [Medicago scutellata] 72 8e-11 gb|ADV40042.1| BBI inhibitor [Lathyrus sativus] 72 1e-10 gb|ADV40041.1| BBI inhibitor [Lathyrus sativus] 72 1e-10 gb|ADV40040.1| BBI inhibitor [Lathyrus sativus] 72 1e-10 gb|ADV40029.1| BBI inhibitor [Lathyrus sativus] gi|318086905|gb|... 72 1e-10 ref|NP_001236539.1| uncharacterized protein LOC100305522 precurs... 72 1e-10 ref|NP_001237767.1| Bowman-Birk type protease inhibitor-like pre... 72 1e-10 >sp|P16346.1|IBBWT_MEDSA RecName: Full=Bowman-Birk type wound-induced trypsin inhibitor Length = 58 Score = 75.9 bits (185), Expect = 6e-12 Identities = 30/54 (55%), Positives = 34/54 (62%) Frame = -3 Query: 344 CCNVEICALSCPPQCRCYDVDEACLGGCKDCRCTKSNPPQCQCFDVTPYDHLKC 183 CCN C S PPQCRC D+ E C CK C CTKS PPQC C D+T + + KC Sbjct: 4 CCNFCPCTRSIPPQCRCTDIGETCHSACKTCLCTKSIPPQCHCADITNFCYPKC 57 >sp|P85172.1|IBB1_LUPAL RecName: Full=Bowman-Birk type proteinase inhibitor; Short=LaBBI Length = 63 Score = 75.5 bits (184), Expect = 7e-12 Identities = 28/55 (50%), Positives = 36/55 (65%) Frame = -3 Query: 347 PCCNVEICALSCPPQCRCYDVDEACLGGCKDCRCTKSNPPQCQCFDVTPYDHLKC 183 PCC+ +C S PPQCRC D+ E C CK C CT+S PPQC+C D+T + + C Sbjct: 6 PCCDSCLCTRSIPPQCRCTDIGETCHSACKSCICTRSFPPQCRCSDITHFCYKPC 60 >emb|CAA56254.1| serine proteinase inhibitor [Medicago sativa] Length = 113 Score = 75.5 bits (184), Expect = 7e-12 Identities = 29/54 (53%), Positives = 35/54 (64%) Frame = -3 Query: 344 CCNVEICALSCPPQCRCYDVDEACLGGCKDCRCTKSNPPQCQCFDVTPYDHLKC 183 CCN C S PPQCRC D+ E C CK C CT+S PPQC+C D+T + + KC Sbjct: 59 CCNFCPCTKSIPPQCRCSDIGETCHSACKSCICTRSYPPQCRCTDITNFCYPKC 112 >emb|CAA56253.1| serine proteinase inhibitor [Medicago sativa] Length = 113 Score = 75.5 bits (184), Expect = 7e-12 Identities = 29/54 (53%), Positives = 35/54 (64%) Frame = -3 Query: 344 CCNVEICALSCPPQCRCYDVDEACLGGCKDCRCTKSNPPQCQCFDVTPYDHLKC 183 CCN C S PPQCRC D+ E C CK C CT+S PPQC+C D+T + + KC Sbjct: 59 CCNFCPCTRSIPPQCRCTDIGETCHSACKSCLCTRSIPPQCRCTDITNFCYPKC 112 >emb|CAC24564.1| trypsin inhibitor [Pisum sativum] Length = 104 Score = 73.9 bits (180), Expect = 2e-11 Identities = 27/54 (50%), Positives = 36/54 (66%) Frame = -3 Query: 344 CCNVEICALSCPPQCRCYDVDEACLGGCKDCRCTKSNPPQCQCFDVTPYDHLKC 183 CC+ +C S PP+CRC D+ E C CK C CT+S PPQC+C D+T + + KC Sbjct: 50 CCDSCLCTRSIPPRCRCNDIGETCHSACKTCICTRSLPPQCRCIDITDFCYEKC 103 >gb|ACJ86027.1| unknown [Medicago truncatula] gi|388496776|gb|AFK36454.1| unknown [Medicago truncatula] Length = 110 Score = 72.4 bits (176), Expect = 6e-11 Identities = 27/54 (50%), Positives = 35/54 (64%) Frame = -3 Query: 344 CCNVEICALSCPPQCRCYDVDEACLGGCKDCRCTKSNPPQCQCFDVTPYDHLKC 183 CC+ C S PPQC+C DV E C CK C CT+S PPQC+C+D+T + + C Sbjct: 56 CCDFCPCTRSIPPQCQCTDVKEKCHSACKSCLCTRSFPPQCRCYDITNFCYSSC 109 >ref|XP_003623932.1| Trypsin inhibitor [Medicago truncatula] gi|355498947|gb|AES80150.1| Trypsin inhibitor [Medicago truncatula] Length = 86 Score = 72.4 bits (176), Expect = 6e-11 Identities = 28/54 (51%), Positives = 33/54 (61%) Frame = -3 Query: 344 CCNVEICALSCPPQCRCYDVDEACLGGCKDCRCTKSNPPQCQCFDVTPYDHLKC 183 CC+ C S PPQC C D+ E C CK C CTKS PPQC C D+T + + KC Sbjct: 32 CCDSCPCTKSIPPQCHCTDIGETCHSACKSCLCTKSIPPQCHCADITDFCYPKC 85 >emb|CAH04454.1| putative trypsin inhibitor [Lens nigricans] Length = 104 Score = 72.4 bits (176), Expect = 6e-11 Identities = 28/54 (51%), Positives = 34/54 (62%) Frame = -3 Query: 344 CCNVEICALSCPPQCRCYDVDEACLGGCKDCRCTKSNPPQCQCFDVTPYDHLKC 183 CCN C S PP+CRC D+ E C CK C CT+S PPQC+C DVT + + C Sbjct: 50 CCNSCPCTRSIPPKCRCTDIGETCHSACKSCLCTRSIPPQCRCTDVTNFCYKNC 103 >pdb|1PBI|A Chain A, Crystal Structure Of A Bowman-Birk Inhibitor From Pea Seeds gi|4389008|pdb|1PBI|B Chain B, Crystal Structure Of A Bowman-Birk Inhibitor From Pea Seeds Length = 72 Score = 72.0 bits (175), Expect = 8e-11 Identities = 28/59 (47%), Positives = 34/59 (57%) Frame = -3 Query: 353 KPPCCNVEICALSCPPQCRCYDVDEACLGGCKDCRCTKSNPPQCQCFDVTPYDHLKCPN 177 K CC+ +C S PP CRC DV E C C C C SNPP+CQCFD + + +C N Sbjct: 5 KSACCDTCLCTKSNPPTCRCVDVGETCHSACLSCICAYSNPPKCQCFDTQKFCYKQCHN 63 >sp|P80321.2|IBB_MEDSC RecName: Full=Bowman-Birk type proteinase inhibitor; AltName: Full=MSTI gi|30749513|pdb|1MVZ|A Chain A, Nmr Solution Structure Of A Bowman Birk Inhibitor Isolated From Snail Medic Seeds (Medicago Scutellata) gi|146387522|pdb|2ILN|I Chain I, Crystal Structure Of The Bowman-Birk Inhibitor From Snail Medic Seeds In Complex With Bovine Trypsin Length = 62 Score = 72.0 bits (175), Expect = 8e-11 Identities = 27/54 (50%), Positives = 35/54 (64%) Frame = -3 Query: 344 CCNVEICALSCPPQCRCYDVDEACLGGCKDCRCTKSNPPQCQCFDVTPYDHLKC 183 CC+ C S PPQC+C DV E C CK C CT+S PPQC+C+D+T + + C Sbjct: 8 CCDFCPCTRSIPPQCQCTDVREKCHSACKSCLCTRSFPPQCRCYDITDFCYPSC 61 >gb|AFK40073.1| unknown [Lotus japonicus] Length = 119 Score = 72.0 bits (175), Expect = 8e-11 Identities = 28/54 (51%), Positives = 34/54 (62%) Frame = -3 Query: 344 CCNVEICALSCPPQCRCYDVDEACLGGCKDCRCTKSNPPQCQCFDVTPYDHLKC 183 CCN C S PPQCRC D+ E C CK C CT+S PPQC+C D+T + + C Sbjct: 59 CCNSCPCTRSIPPQCRCTDIGETCHSACKACICTRSIPPQCRCLDITNFCYDPC 112 >ref|XP_003623935.1| Bowman-Birk type proteinase inhibitor [Medicago truncatula] gi|355498950|gb|AES80153.1| Bowman-Birk type proteinase inhibitor [Medicago truncatula] Length = 242 Score = 72.0 bits (175), Expect = 8e-11 Identities = 27/54 (50%), Positives = 35/54 (64%) Frame = -3 Query: 344 CCNVEICALSCPPQCRCYDVDEACLGGCKDCRCTKSNPPQCQCFDVTPYDHLKC 183 CC+ C S PPQC+C DV E C CK C CT+S PPQC+C+D+T + + C Sbjct: 56 CCDFCPCTRSIPPQCQCTDVKEKCHSACKSCLCTRSFPPQCRCYDITNFCYPSC 109 >emb|CAH04453.1| putative trypsin inhibitor [Lens ervoides] Length = 104 Score = 72.0 bits (175), Expect = 8e-11 Identities = 28/54 (51%), Positives = 34/54 (62%) Frame = -3 Query: 344 CCNVEICALSCPPQCRCYDVDEACLGGCKDCRCTKSNPPQCQCFDVTPYDHLKC 183 CCN C S PP+C C D+ E C CK C CT+S PPQC+C DVT + + KC Sbjct: 50 CCNSCPCTRSIPPKCSCSDIGETCHSACKSCLCTRSIPPQCRCTDVTNFCYKKC 103 >gb|AAQ10729.1| trypsin inhibitor [Medicago scutellata] Length = 110 Score = 72.0 bits (175), Expect = 8e-11 Identities = 27/54 (50%), Positives = 35/54 (64%) Frame = -3 Query: 344 CCNVEICALSCPPQCRCYDVDEACLGGCKDCRCTKSNPPQCQCFDVTPYDHLKC 183 CC+ C S PPQC+C DV E C CK C CT+S PPQC+C+D+T + + C Sbjct: 56 CCDFCPCTRSIPPQCQCTDVREKCHSACKSCLCTRSFPPQCRCYDITDFCYPSC 109 >gb|ADV40042.1| BBI inhibitor [Lathyrus sativus] Length = 114 Score = 71.6 bits (174), Expect = 1e-10 Identities = 28/59 (47%), Positives = 34/59 (57%) Frame = -3 Query: 353 KPPCCNVEICALSCPPQCRCYDVDEACLGGCKDCRCTKSNPPQCQCFDVTPYDHLKCPN 177 K CC+ +C S PP CRC D+ E C C C CT S PPQC+CFD T + + C N Sbjct: 47 KSACCDTCLCTKSNPPICRCVDIRETCHSACNSCVCTASIPPQCRCFDTTKFCYKACHN 105 >gb|ADV40041.1| BBI inhibitor [Lathyrus sativus] Length = 114 Score = 71.6 bits (174), Expect = 1e-10 Identities = 28/59 (47%), Positives = 34/59 (57%) Frame = -3 Query: 353 KPPCCNVEICALSCPPQCRCYDVDEACLGGCKDCRCTKSNPPQCQCFDVTPYDHLKCPN 177 K CC+ +C S PP CRC D+ E C C C CT S PPQC+CFD T + + C N Sbjct: 47 KSACCDTCLCTKSNPPICRCVDIRETCHSACNSCVCTASIPPQCRCFDTTKFCYKACHN 105 >gb|ADV40040.1| BBI inhibitor [Lathyrus sativus] Length = 114 Score = 71.6 bits (174), Expect = 1e-10 Identities = 28/59 (47%), Positives = 34/59 (57%) Frame = -3 Query: 353 KPPCCNVEICALSCPPQCRCYDVDEACLGGCKDCRCTKSNPPQCQCFDVTPYDHLKCPN 177 K CC+ +C S PP CRC D+ E C C C CT S PPQC+CFD T + + C N Sbjct: 47 KSACCDTCLCTKSNPPICRCVDIRETCHSACNSCVCTASIPPQCRCFDTTKFCYKACHN 105 >gb|ADV40029.1| BBI inhibitor [Lathyrus sativus] gi|318086905|gb|ADV40053.1| BBI inhibitor [Lathyrus sativus] Length = 114 Score = 71.6 bits (174), Expect = 1e-10 Identities = 28/59 (47%), Positives = 34/59 (57%) Frame = -3 Query: 353 KPPCCNVEICALSCPPQCRCYDVDEACLGGCKDCRCTKSNPPQCQCFDVTPYDHLKCPN 177 K CC+ +C S PP CRC D+ E C C C CT S PPQC+CFD T + + C N Sbjct: 47 KSACCDTCLCTKSNPPICRCVDIRETCHSACNSCVCTASIPPQCRCFDTTKFCYKACHN 105 >ref|NP_001236539.1| uncharacterized protein LOC100305522 precursor [Glycine max] gi|255625791|gb|ACU13240.1| unknown [Glycine max] Length = 117 Score = 71.6 bits (174), Expect = 1e-10 Identities = 28/54 (51%), Positives = 33/54 (61%) Frame = -3 Query: 344 CCNVEICALSCPPQCRCYDVDEACLGGCKDCRCTKSNPPQCQCFDVTPYDHLKC 183 CCN C S PPQCRC D+ E C CK C CT+S PPQC C D+T + + C Sbjct: 56 CCNSCPCTKSIPPQCRCSDIGETCHSACKTCICTRSIPPQCHCSDITNFCYEPC 109 >ref|NP_001237767.1| Bowman-Birk type protease inhibitor-like precursor [Glycine max] gi|168259034|gb|ACA23206.1| putative Bowman-Birk type protease inhibitor [Glycine max] Length = 117 Score = 71.6 bits (174), Expect = 1e-10 Identities = 28/54 (51%), Positives = 33/54 (61%) Frame = -3 Query: 344 CCNVEICALSCPPQCRCYDVDEACLGGCKDCRCTKSNPPQCQCFDVTPYDHLKC 183 CCN C S PPQCRC D+ E C CK C CT+S PPQC C D+T + + C Sbjct: 56 CCNSCPCTKSIPPQCRCSDIGETCHSACKTCICTRSIPPQCHCSDITNFCYEPC 109