BLASTX nr result
ID: Cnidium21_contig00048702
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00048702 (331 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_006291799.1| orf31 gene product (mitochondrion) [Daucus c... 89 5e-16 >ref|YP_006291799.1| orf31 gene product (mitochondrion) [Daucus carota subsp. sativus] gi|374081977|gb|AEY81169.1| orf31 (mitochondrion) [Daucus carota subsp. sativus] Length = 131 Score = 88.6 bits (218), Expect = 5e-16 Identities = 41/49 (83%), Positives = 42/49 (85%) Frame = -3 Query: 149 MCTPKVRKRPGKAVACQNSSHKVNYPFYCACIHYSYSAKAFMPSHKKPK 3 MC PKVRKRPGK+ CQNS HKVNYPF CACI YSYSAKAFMPS KKPK Sbjct: 1 MCAPKVRKRPGKS--CQNSPHKVNYPFSCACIRYSYSAKAFMPSPKKPK 47