BLASTX nr result
ID: Cnidium21_contig00048674
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00048674 (291 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002533815.1| conserved hypothetical protein [Ricinus comm... 67 2e-09 ref|XP_002326434.1| predicted protein [Populus trichocarpa] gi|1... 63 2e-08 ref|XP_002303335.1| predicted protein [Populus trichocarpa] gi|2... 58 7e-07 ref|XP_003632814.1| PREDICTED: uncharacterized protein LOC100854... 57 2e-06 >ref|XP_002533815.1| conserved hypothetical protein [Ricinus communis] gi|223526252|gb|EEF28568.1| conserved hypothetical protein [Ricinus communis] Length = 165 Score = 66.6 bits (161), Expect = 2e-09 Identities = 33/60 (55%), Positives = 45/60 (75%), Gaps = 3/60 (5%) Frame = -3 Query: 289 PIYGNGGRTGSNRLWRQNSGPLTSIF---KRTEEQMPYICLDKLNSNLHGVESYGPVYLV 119 PIYG+GG ++ RQ SGPLT++F KRT ++PY+CLD+L+S HG ++YGPVYLV Sbjct: 106 PIYGSGGLAVESKHRRQTSGPLTNLFNSTKRTGNEIPYMCLDQLSSP-HGAKAYGPVYLV 164 >ref|XP_002326434.1| predicted protein [Populus trichocarpa] gi|118483226|gb|ABK93516.1| unknown [Populus trichocarpa] gi|222833756|gb|EEE72233.1| predicted protein [Populus trichocarpa] Length = 161 Score = 63.2 bits (152), Expect = 2e-08 Identities = 35/60 (58%), Positives = 43/60 (71%), Gaps = 3/60 (5%) Frame = -3 Query: 289 PIYGNGGRTGSNRLWRQNSGPLTSIF---KRTEEQMPYICLDKLNSNLHGVESYGPVYLV 119 PIYG+ R R RQ SGPLT++F KR E + PY+CLD+LN N HGV++YGPVYLV Sbjct: 103 PIYGSA-RGVDARHRRQTSGPLTNLFNHSKRVENETPYMCLDQLN-NPHGVKAYGPVYLV 160 >ref|XP_002303335.1| predicted protein [Populus trichocarpa] gi|222840767|gb|EEE78314.1| predicted protein [Populus trichocarpa] Length = 161 Score = 58.2 bits (139), Expect = 7e-07 Identities = 33/60 (55%), Positives = 42/60 (70%), Gaps = 3/60 (5%) Frame = -3 Query: 289 PIYGNGGRTGSNRLWRQNSGPLTSIFKRT---EEQMPYICLDKLNSNLHGVESYGPVYLV 119 PIYG+G R R RQ SGPLT++F R+ E + Y+CLD+LN N GV++YGPVYLV Sbjct: 103 PIYGSG-RGVEIRYRRQTSGPLTNLFNRSKSVENENRYVCLDQLN-NPQGVKAYGPVYLV 160 >ref|XP_003632814.1| PREDICTED: uncharacterized protein LOC100854504 [Vitis vinifera] gi|297742923|emb|CBI35790.3| unnamed protein product [Vitis vinifera] Length = 162 Score = 57.0 bits (136), Expect = 2e-06 Identities = 30/60 (50%), Positives = 43/60 (71%), Gaps = 3/60 (5%) Frame = -3 Query: 289 PIYGNGGRTGSNRLWRQNSGPLTSIF---KRTEEQMPYICLDKLNSNLHGVESYGPVYLV 119 PIYG+G RT S + R SGPLTS+F ++ E +PY+ L++L+S+ H ++YGPVYLV Sbjct: 104 PIYGSGRRTDSKQR-RPTSGPLTSLFNPTRKAETDIPYVSLNQLSSS-HSAQAYGPVYLV 161