BLASTX nr result
ID: Cnidium21_contig00048486
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00048486 (306 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAF01788.1| putative Ty3-gypsy-like retroelement pol polypro... 76 2e-12 gb|AAD19756.1| putative Ty3-gypsy-like retroelement pol polyprot... 76 2e-12 emb|CAN79395.1| hypothetical protein VITISV_010430 [Vitis vinifera] 57 2e-06 ref|XP_003600463.1| hypothetical protein MTR_3g061470 [Medicago ... 56 3e-06 >dbj|BAF01788.1| putative Ty3-gypsy-like retroelement pol polyprotein [Arabidopsis thaliana] Length = 127 Score = 76.3 bits (186), Expect = 2e-12 Identities = 40/62 (64%), Positives = 45/62 (72%) Frame = -3 Query: 187 DKCKWVKVFKNGDDVMVFLCKEWFPVRTYNKLQPCKYVQFKVLGKINDTCYVLALPNSIN 8 DK + KVFK GDDVMV L K F V TYNK++P KY FKVL KIND YV+ALP S+N Sbjct: 28 DKRRRFKVFKEGDDVMVLLRKGRFAVGTYNKVKPRKYGPFKVLRKINDNAYVVALPKSMN 87 Query: 7 IS 2 IS Sbjct: 88 IS 89 >gb|AAD19756.1| putative Ty3-gypsy-like retroelement pol polyprotein [Arabidopsis thaliana] Length = 280 Score = 76.3 bits (186), Expect = 2e-12 Identities = 40/62 (64%), Positives = 45/62 (72%) Frame = -3 Query: 187 DKCKWVKVFKNGDDVMVFLCKEWFPVRTYNKLQPCKYVQFKVLGKINDTCYVLALPNSIN 8 DK + KVFK GDDVMV L K F V TYNK++P KY FKVL KIND YV+ALP S+N Sbjct: 181 DKRRRFKVFKEGDDVMVLLRKGRFAVGTYNKVKPRKYGPFKVLRKINDNAYVVALPKSMN 240 Query: 7 IS 2 IS Sbjct: 241 IS 242 >emb|CAN79395.1| hypothetical protein VITISV_010430 [Vitis vinifera] Length = 391 Score = 57.0 bits (136), Expect = 2e-06 Identities = 29/62 (46%), Positives = 39/62 (62%) Frame = -3 Query: 187 DKCKWVKVFKNGDDVMVFLCKEWFPVRTYNKLQPCKYVQFKVLGKINDTCYVLALPNSIN 8 D+ + +K+F GD VMV CK FP+ TYNKL+ K F+VL KI D Y + L ++N Sbjct: 284 DRHRCLKLFNEGDLVMVHFCKNCFPIGTYNKLKDKKIGPFRVLKKIGDKAYKIDLLANMN 343 Query: 7 IS 2 IS Sbjct: 344 IS 345 >ref|XP_003600463.1| hypothetical protein MTR_3g061470 [Medicago truncatula] gi|355489511|gb|AES70714.1| hypothetical protein MTR_3g061470 [Medicago truncatula] Length = 133 Score = 56.2 bits (134), Expect = 3e-06 Identities = 27/41 (65%), Positives = 31/41 (75%) Frame = -3 Query: 124 EWFPVRTYNKLQPCKYVQFKVLGKINDTCYVLALPNSINIS 2 E FPV TY+KL+PCKY FKV KIND YV+AL S+NIS Sbjct: 66 ERFPVSTYSKLKPCKYGPFKVTRKINDNAYVVALLESMNIS 106