BLASTX nr result
ID: Cnidium21_contig00048094
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00048094 (427 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002510967.1| pentatricopeptide repeat-containing protein,... 59 4e-07 >ref|XP_002510967.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223550082|gb|EEF51569.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 774 Score = 58.9 bits (141), Expect = 4e-07 Identities = 24/39 (61%), Positives = 29/39 (74%) Frame = +3 Query: 3 STLICSFCKADMLDNAYALLCRGVSNGFVPNDATWYFLI 119 +TLIC C+A M D+AY LL RGV N F+PND TWY L+ Sbjct: 664 NTLICWHCRAGMFDDAYLLLLRGVENAFIPNDVTWYILV 702