BLASTX nr result
ID: Cnidium21_contig00047899
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00047899 (450 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002271732.1| PREDICTED: uncharacterized protein LOC100248... 79 4e-13 ref|XP_002516955.1| conserved hypothetical protein [Ricinus comm... 74 9e-12 ref|XP_003534839.1| PREDICTED: uncharacterized protein LOC100786... 74 2e-11 ref|XP_002328599.1| predicted protein [Populus trichocarpa] gi|2... 73 2e-11 ref|XP_003546365.1| PREDICTED: uncharacterized protein LOC100777... 71 1e-10 >ref|XP_002271732.1| PREDICTED: uncharacterized protein LOC100248252 [Vitis vinifera] Length = 187 Score = 79.0 bits (193), Expect = 4e-13 Identities = 39/67 (58%), Positives = 45/67 (67%), Gaps = 1/67 (1%) Frame = +1 Query: 253 MSNY-PVFPITDTQHFSDYGFHPHFDYFQVLEAARKHKTGGKTIDGLHFKLQKPTVSHEL 429 MSN P+FP+ + HFSDYGF P DYFQVLE ARKHK ++ID LHFKLQKP + Sbjct: 1 MSNQCPIFPMPEPHHFSDYGFDPQIDYFQVLEEARKHKREARSIDSLHFKLQKPISKDDS 60 Query: 430 DYSKIIK 450 S IK Sbjct: 61 KKSGKIK 67 >ref|XP_002516955.1| conserved hypothetical protein [Ricinus communis] gi|223544043|gb|EEF45569.1| conserved hypothetical protein [Ricinus communis] Length = 184 Score = 74.3 bits (181), Expect = 9e-12 Identities = 35/60 (58%), Positives = 40/60 (66%), Gaps = 1/60 (1%) Frame = +1 Query: 265 PVFPITDTQHFSDYGFHPHFDYFQVLEAARKHK-TGGKTIDGLHFKLQKPTVSHELDYSK 441 P+FP+ + QHFSDYGF P DYFQ LE ARKHK ++ID LHFKLQKP E K Sbjct: 6 PIFPMPEPQHFSDYGFDPQIDYFQFLEEARKHKRETARSIDSLHFKLQKPISKDEYSNKK 65 >ref|XP_003534839.1| PREDICTED: uncharacterized protein LOC100786266 [Glycine max] Length = 182 Score = 73.6 bits (179), Expect = 2e-11 Identities = 37/55 (67%), Positives = 41/55 (74%), Gaps = 2/55 (3%) Frame = +1 Query: 253 MSNY-PVFPITDTQHFSDYGFHPHFDYFQVLEAARKHK-TGGKTIDGLHFKLQKP 411 MSN PVFPI D QHFSDYGF P +YFQVLE A KHK ++ID +HFKLQKP Sbjct: 1 MSNKSPVFPIPDPQHFSDYGFDPQINYFQVLEEAMKHKRETARSIDSIHFKLQKP 55 >ref|XP_002328599.1| predicted protein [Populus trichocarpa] gi|222838581|gb|EEE76946.1| predicted protein [Populus trichocarpa] Length = 190 Score = 73.2 bits (178), Expect = 2e-11 Identities = 35/61 (57%), Positives = 39/61 (63%), Gaps = 4/61 (6%) Frame = +1 Query: 256 SNYPVFPITDTQHFSDYGFHPHFDYFQVLEAARKHK----TGGKTIDGLHFKLQKPTVSH 423 S P+FPI + QHFSDYGF P DYFQ LE AR HK T ++D LHFKLQKP Sbjct: 3 SKSPIFPIPEPQHFSDYGFDPQIDYFQFLEEARNHKRETTTTRSSVDSLHFKLQKPISKE 62 Query: 424 E 426 E Sbjct: 63 E 63 >ref|XP_003546365.1| PREDICTED: uncharacterized protein LOC100777661 [Glycine max] Length = 184 Score = 70.9 bits (172), Expect = 1e-10 Identities = 37/60 (61%), Positives = 41/60 (68%), Gaps = 2/60 (3%) Frame = +1 Query: 253 MSNY-PVFPITDTQHFSDYGFHPHFDYFQVLEAARKHK-TGGKTIDGLHFKLQKPTVSHE 426 MSN PVFPI D QHFSDYGF P +YFQVLE A KHK ++ID + FKLQKP E Sbjct: 1 MSNKSPVFPIPDPQHFSDYGFDPQINYFQVLEEAMKHKRETARSIDSIQFKLQKPISKDE 60