BLASTX nr result
ID: Cnidium21_contig00047808
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00047808 (269 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_564516.2| cell wall / vacuolar inhibitor of fructosidase ... 85 5e-15 gb|AAG51534.1|AC051631_14 hypothetical protein; 80318-81409 [Ara... 85 5e-15 ref|XP_002894085.1| hypothetical protein ARALYDRAFT_891603 [Arab... 85 5e-15 ref|XP_002519258.1| Pectinesterase inhibitor, putative [Ricinus ... 82 3e-14 ref|XP_003609812.1| Pectinesterase inhibitor [Medicago truncatul... 78 7e-13 >ref|NP_564516.2| cell wall / vacuolar inhibitor of fructosidase 1 [Arabidopsis thaliana] gi|387942476|sp|F4HWQ8.1|CVIF1_ARATH RecName: Full=Cell wall / vacuolar inhibitor of fructosidase 1; Short=AtC/VIF1; Flags: Precursor gi|332194111|gb|AEE32232.1| cell wall / vacuolar inhibitor of fructosidase 1 [Arabidopsis thaliana] Length = 205 Score = 85.1 bits (209), Expect = 5e-15 Identities = 44/93 (47%), Positives = 59/93 (63%), Gaps = 4/93 (4%) Frame = +2 Query: 2 KTPKYALCVSTLRSNPRSWTADVAGLGYIVVETVKAKSTAGLNCINKLSRSNPMLKKRLT 181 +TP + LCVS L S+PR +AD +GL I+++ +K +T LN IN L + P LK+ L Sbjct: 32 ETPDFNLCVSLLNSDPRGSSADTSGLALILIDKIKGLATKTLNEINGLYKKRPELKRALD 91 Query: 182 ECLERYKNILNDFIPEA----EQGPPKFAEDGM 268 EC RYK ILN +PEA +G PKF EDG+ Sbjct: 92 ECSRRYKTILNADVPEAIEAISKGVPKFGEDGV 124 >gb|AAG51534.1|AC051631_14 hypothetical protein; 80318-81409 [Arabidopsis thaliana] gi|15724357|gb|AAL06571.1|AF412119_1 At1g47960/T2J15_13 [Arabidopsis thaliana] gi|15810209|gb|AAL07005.1| At1g47960/T2J15_13 [Arabidopsis thaliana] gi|19699120|gb|AAL90926.1| At1g47960/T2J15_13 [Arabidopsis thaliana] gi|21536549|gb|AAM60881.1| unknown [Arabidopsis thaliana] Length = 166 Score = 85.1 bits (209), Expect = 5e-15 Identities = 44/93 (47%), Positives = 59/93 (63%), Gaps = 4/93 (4%) Frame = +2 Query: 2 KTPKYALCVSTLRSNPRSWTADVAGLGYIVVETVKAKSTAGLNCINKLSRSNPMLKKRLT 181 +TP + LCVS L S+PR +AD +GL I+++ +K +T LN IN L + P LK+ L Sbjct: 32 ETPDFNLCVSLLNSDPRGSSADTSGLALILIDKIKGLATKTLNEINGLYKKRPELKRALD 91 Query: 182 ECLERYKNILNDFIPEA----EQGPPKFAEDGM 268 EC RYK ILN +PEA +G PKF EDG+ Sbjct: 92 ECSRRYKTILNADVPEAIEAISKGVPKFGEDGV 124 >ref|XP_002894085.1| hypothetical protein ARALYDRAFT_891603 [Arabidopsis lyrata subsp. lyrata] gi|297339927|gb|EFH70344.1| hypothetical protein ARALYDRAFT_891603 [Arabidopsis lyrata subsp. lyrata] Length = 152 Score = 85.1 bits (209), Expect = 5e-15 Identities = 44/93 (47%), Positives = 59/93 (63%), Gaps = 4/93 (4%) Frame = +2 Query: 2 KTPKYALCVSTLRSNPRSWTADVAGLGYIVVETVKAKSTAGLNCINKLSRSNPMLKKRLT 181 +TP + LCVS L S+PR +AD +GL I+++ +K +T LN IN L + P LK+ L Sbjct: 18 ETPDFNLCVSLLNSDPRGSSADTSGLALILIDKIKGLTTKTLNEINGLYKKRPELKRALD 77 Query: 182 ECLERYKNILNDFIPEA----EQGPPKFAEDGM 268 EC RYK ILN +PEA +G PKF EDG+ Sbjct: 78 ECSRRYKTILNADVPEAIEAISKGVPKFGEDGV 110 >ref|XP_002519258.1| Pectinesterase inhibitor, putative [Ricinus communis] gi|223541573|gb|EEF43122.1| Pectinesterase inhibitor, putative [Ricinus communis] Length = 178 Score = 82.4 bits (202), Expect = 3e-14 Identities = 44/91 (48%), Positives = 58/91 (63%), Gaps = 4/91 (4%) Frame = +2 Query: 2 KTPKYALCVSTLRSNPRSWTADVAGLGYIVVETVKAKSTAGLNCINKLSRSNPMLKKRLT 181 +TP Y LCV++L S+PRS AD GL I+V+ +KA++TA LN I +P LKK+LT Sbjct: 44 QTPNYNLCVTSLNSDPRSAKADTTGLALIMVDIIKARATASLNFIRHQYHKSPRLKKQLT 103 Query: 182 ECLERYKNILNDFIPEA----EQGPPKFAED 262 C Y IL IPEA ++G PKFA+D Sbjct: 104 SCAHGYDAILTLDIPEAYEALQKGVPKFAQD 134 >ref|XP_003609812.1| Pectinesterase inhibitor [Medicago truncatula] gi|355510867|gb|AES92009.1| Pectinesterase inhibitor [Medicago truncatula] Length = 173 Score = 78.2 bits (191), Expect = 7e-13 Identities = 41/92 (44%), Positives = 59/92 (64%), Gaps = 4/92 (4%) Frame = +2 Query: 2 KTPKYALCVSTLRSNPRSWTADVAGLGYIVVETVKAKSTAGLNCINKLSRSNPMLKKRLT 181 +TP YA C+ L+S+PRS ADV GL I+V+ +K+K+ LN IN+L + + K+ L Sbjct: 39 QTPNYANCIHYLKSDPRSSDADVTGLALIMVDIIKSKANTALNKINQLIKGSHDQKEALN 98 Query: 182 ECLERYKNILNDFIPEA----EQGPPKFAEDG 265 C RY+ IL +P++ +QG PKFAEDG Sbjct: 99 SCAGRYRAILVADVPKSVAALKQGDPKFAEDG 130