BLASTX nr result
ID: Cnidium21_contig00047781
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00047781 (343 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001118286.2| uncharacterized protein [Arabidopsis thalian... 81 8e-14 ref|YP_173470.1| cytochrome c maturation protein CcmFc [Nicotian... 67 1e-09 ref|YP_006291801.1| ccmFc gene product (mitochondrion) [Daucus c... 67 1e-09 ref|YP_004237254.1| cytochrome c biogenesis FC (mitochondrion) [... 67 1e-09 ref|XP_002534941.1| conserved hypothetical protein [Ricinus comm... 67 1e-09 >ref|NP_001118286.2| uncharacterized protein [Arabidopsis thaliana] gi|330251011|gb|AEC06105.1| uncharacterized protein [Arabidopsis thaliana] Length = 279 Score = 81.3 bits (199), Expect = 8e-14 Identities = 40/45 (88%), Positives = 41/45 (91%) Frame = +3 Query: 207 LIFSREAKLERIEQMVQLHNFFFFITSMVVPRGTAAPVLLKWFVS 341 L+F REAKLERIEQMVQLHNFFFFI MVVP GTAAPVLLKWFVS Sbjct: 159 LLFFREAKLERIEQMVQLHNFFFFIIFMVVPCGTAAPVLLKWFVS 203 >ref|YP_173470.1| cytochrome c maturation protein CcmFc [Nicotiana tabacum] Length = 438 Score = 67.0 bits (162), Expect = 1e-09 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +3 Query: 249 MVQLHNFFFFITSMVVPRGTAAPVLLKWFVS 341 MVQLHNFFFFITSMVVPRGTAAPVLLKWFVS Sbjct: 1 MVQLHNFFFFITSMVVPRGTAAPVLLKWFVS 31 >ref|YP_006291801.1| ccmFc gene product (mitochondrion) [Daucus carota subsp. sativus] gi|374081937|gb|AEY81129.1| cytochrome c biogenesis FC (mitochondrion) [Daucus carota subsp. sativus] Length = 450 Score = 67.0 bits (162), Expect = 1e-09 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +3 Query: 249 MVQLHNFFFFITSMVVPRGTAAPVLLKWFVS 341 MVQLHNFFFFITSMVVPRGTAAPVLLKWFVS Sbjct: 1 MVQLHNFFFFITSMVVPRGTAAPVLLKWFVS 31 >ref|YP_004237254.1| cytochrome c biogenesis FC (mitochondrion) [Ricinus communis] gi|322394260|gb|ADW96017.1| cytochrome c biogenesis FC (mitochondrion) [Ricinus communis] Length = 439 Score = 67.0 bits (162), Expect = 1e-09 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +3 Query: 249 MVQLHNFFFFITSMVVPRGTAAPVLLKWFVS 341 MVQLHNFFFFITSMVVPRGTAAPVLLKWFVS Sbjct: 1 MVQLHNFFFFITSMVVPRGTAAPVLLKWFVS 31 >ref|XP_002534941.1| conserved hypothetical protein [Ricinus communis] gi|223524327|gb|EEF27442.1| conserved hypothetical protein [Ricinus communis] Length = 445 Score = 67.0 bits (162), Expect = 1e-09 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +3 Query: 249 MVQLHNFFFFITSMVVPRGTAAPVLLKWFVS 341 MVQLHNFFFFITSMVVPRGTAAPVLLKWFVS Sbjct: 1 MVQLHNFFFFITSMVVPRGTAAPVLLKWFVS 31