BLASTX nr result
ID: Cnidium21_contig00047712
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00047712 (414 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002323520.1| predicted protein [Populus trichocarpa] gi|2... 62 5e-08 ref|XP_002532992.1| nucleic acid binding protein, putative [Rici... 56 3e-06 >ref|XP_002323520.1| predicted protein [Populus trichocarpa] gi|222868150|gb|EEF05281.1| predicted protein [Populus trichocarpa] Length = 300 Score = 62.0 bits (149), Expect = 5e-08 Identities = 48/129 (37%), Positives = 74/129 (57%), Gaps = 1/129 (0%) Frame = -2 Query: 386 LAPSFSSPILKEQQNKTSTLSPLLWSSFIADRCCNIGDLDKQ-EKDYNFLEPKIRAKRDY 210 ++P F+S I++EQQ ++ SP + +RC +I L + E++ +E RAK DY Sbjct: 160 ISPPFTSFIVEEQQKRSHKSSPPPQTKLTKERC-HISSLSTEGEQNSRKIESGCRAKVDY 218 Query: 209 VEADLSASPKVVICENDHKQTSANGEKDENTGFKRRRLTDDATLLFFPKRNSVDKNITVS 30 V+ DLS S +V+ + S + +E K+RR+ D ++L FF K NSVDK+ Sbjct: 219 VQTDLSVSLNLVV---RRTRPSISDCGEEPMSCKKRRI-DKSSLPFFLKCNSVDKH---H 271 Query: 29 SESEVFEIS 3 +SEVFEIS Sbjct: 272 VQSEVFEIS 280 >ref|XP_002532992.1| nucleic acid binding protein, putative [Ricinus communis] gi|223527221|gb|EEF29384.1| nucleic acid binding protein, putative [Ricinus communis] Length = 349 Score = 56.2 bits (134), Expect = 3e-06 Identities = 49/133 (36%), Positives = 70/133 (52%), Gaps = 5/133 (3%) Frame = -2 Query: 386 LAPSFSSPILKEQ-QNKTSTLSPLLWSSFIADRCCNIGDLDKQEKDY--NFLEPKIRAKR 216 L P FSS I+KE+ + SP + +R +I D + E D+ + LE RAK Sbjct: 173 LFPPFSSSIIKEKLDERYRRSSPPSRPNLAEERYYHISD-PRSEGDHKDSILESGCRAKV 231 Query: 215 DYVEADLSASPKVVICENDHKQTSANGEKDENT--GFKRRRLTDDATLLFFPKRNSVDKN 42 DYV+ DL+ S +V+ + + DE T G KRRR T ++L FF K NSVD++ Sbjct: 232 DYVKTDLAVSLNLVVRRTRQAISDDDEAGDEETAIGCKRRR-TSTSSLSFFKKSNSVDRH 290 Query: 41 ITVSSESEVFEIS 3 +SEV EI+ Sbjct: 291 ---HVQSEVIEIT 300