BLASTX nr result
ID: Cnidium21_contig00047602
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cnidium21_contig00047602 (350 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN65039.1| hypothetical protein VITISV_009459 [Vitis vinifera] 69 4e-10 emb|CBI27248.3| unnamed protein product [Vitis vinifera] 63 3e-08 ref|XP_002316103.1| predicted protein [Populus trichocarpa] gi|2... 55 5e-06 >emb|CAN65039.1| hypothetical protein VITISV_009459 [Vitis vinifera] Length = 1250 Score = 68.9 bits (167), Expect = 4e-10 Identities = 31/47 (65%), Positives = 34/47 (72%) Frame = +1 Query: 208 LSILLAGMGTEVHCKSNTPGYYSMTDMNEDSTSSSWSPYYGDKNLLN 348 +SI AGMGT+V CKS PGYYSM D+NEDS S W YYGDK L N Sbjct: 96 ISIYNAGMGTKVQCKSYLPGYYSMRDLNEDSNSGGWPLYYGDKTLTN 142 >emb|CBI27248.3| unnamed protein product [Vitis vinifera] Length = 891 Score = 62.8 bits (151), Expect = 3e-08 Identities = 27/40 (67%), Positives = 29/40 (72%) Frame = +1 Query: 229 MGTEVHCKSNTPGYYSMTDMNEDSTSSSWSPYYGDKNLLN 348 MGT+V CKS PGYYSM D+NEDS S W YYGDK L N Sbjct: 1 MGTKVQCKSYLPGYYSMRDLNEDSNSGGWPLYYGDKTLTN 40 >ref|XP_002316103.1| predicted protein [Populus trichocarpa] gi|222865143|gb|EEF02274.1| predicted protein [Populus trichocarpa] Length = 1114 Score = 55.5 bits (132), Expect = 5e-06 Identities = 23/40 (57%), Positives = 28/40 (70%) Frame = +1 Query: 229 MGTEVHCKSNTPGYYSMTDMNEDSTSSSWSPYYGDKNLLN 348 MGT+V C+S PGY+ M D+NEDS S SW +YGDK N Sbjct: 1 MGTKVQCESYFPGYFPMRDLNEDSNSCSWPLFYGDKTFTN 40